SecReT6
Protein ID: 431803403
SecReT6 ID716
T6SS typei1
Gene symbol-
Locus tagB479_17355
StrainPseudomonas putida HB3267
Repliconchromosome [GenBank: NC_019905] [Browse all T6SS(s) in this replicon]
Location [Strand]3814664..3816154 [-]
Producthypothetical protein
NoteTssA
UniProt IDL0FMV7
KEGG IDppuh:B479_17355
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.80E-17, Aligned region: 54..114
Protein Sequence: 496 a.a.     [Download]
>gi|431803403|ref|YP_007230306.1| hypothetical protein B479_17355 [Pseudomonas putida HB3267]
MSLVAEVTAQEIARLLAPIDAQNRAGLFDVENETYQAIDQEMVKLGGLQEPSIDWAYIEEASRQYLGQEC
KHLRIVAHLGVAWLRSQCWERWGLTLALLAGMVEAYWESAYPKPGPKGFLGKRKLVGMMLNRLLVALPRL
DRFTFSPAHAAAAQGALQRLQQQREAAQLDEAALGELERLLRKHTELSNGLAEPTTDKPPAKGIKSAPLA
EVIATPTPRVSLGNERESRRAMLTMAELINQQDPYDPAGYQLRRFGLWAHIQTPPQTRQGNRTELMAVPQ
DIAGDYEDAIAATAIDAALLQRIEKSVTACPYWIRGSFLAASAATRLAMGEVAEAIRAATARFVQRMPAL
QQLCFSDGKVFVDDQCLAWLRGAQGQSDSDAASQEFATLREELACQLETSGVEAVLLRLQGMQADFRSLR
ERCHTTVIAADLLAARGVSWLAQDLCAGVARTMQETTASAWEPAVFQRLQQYACTVHQGLIGTRNGSQDE
STVEAS
 
Nucleotide Sequence: 1491 bp     [Download]
>gi|431799958|ref|NC_019905.1|:c3816154-3814664 Pseudomonas putida HB3267, complete genome
ATGTCGCTGGTAGCAGAGGTCACCGCACAGGAAATTGCCCGGTTGCTTGCCCCCATCGACGCGCAGAACC
GTGCCGGCCTGTTCGATGTGGAGAACGAAACCTACCAGGCCATTGACCAGGAAATGGTCAAGCTGGGTGG
GCTGCAGGAGCCTTCCATCGACTGGGCCTATATCGAAGAAGCGTCCCGCCAGTACCTGGGCCAGGAGTGC
AAGCACCTGCGCATTGTCGCGCACCTGGGTGTCGCTTGGCTGCGCAGCCAATGCTGGGAGCGCTGGGGTT
TGACCCTCGCACTGCTGGCCGGCATGGTCGAAGCCTATTGGGAAAGCGCATACCCGAAACCGGGCCCCAA
AGGGTTCCTCGGCAAGCGCAAGCTGGTTGGCATGATGCTCAACCGTTTGCTCGTGGCGTTGCCGCGCCTG
GACCGCTTCACGTTCAGCCCCGCGCACGCCGCGGCGGCTCAGGGCGCGCTGCAACGCCTGCAACAGCAGC
GGGAAGCAGCGCAGCTCGATGAAGCGGCCCTTGGCGAACTGGAGCGCCTGCTACGCAAGCACACGGAACT
TTCAAACGGCCTTGCCGAGCCCACCACGGACAAGCCCCCTGCAAAGGGCATCAAGTCTGCGCCACTGGCC
GAGGTCATTGCCACGCCGACGCCCCGTGTGTCGTTGGGCAACGAGCGCGAATCACGAAGGGCCATGCTGA
CCATGGCCGAGCTGATCAATCAACAGGACCCTTACGATCCTGCTGGCTACCAGTTGCGTCGGTTCGGCTT
GTGGGCGCACATCCAGACGCCGCCTCAAACCAGGCAGGGCAACCGCACGGAGCTGATGGCGGTGCCGCAG
GACATTGCCGGGGACTATGAAGATGCCATTGCCGCTACTGCAATCGACGCGGCCCTGCTGCAGCGGATCG
AAAAGAGCGTGACGGCTTGCCCCTACTGGATTCGCGGCAGCTTTCTGGCAGCGAGCGCTGCCACGCGGCT
GGCGATGGGCGAGGTGGCTGAGGCCATTCGCGCTGCGACCGCGCGGTTTGTGCAGCGCATGCCCGCGCTG
CAGCAGTTGTGCTTCAGCGACGGCAAGGTATTTGTCGATGACCAATGTCTGGCGTGGCTCAGGGGGGCGC
AAGGGCAATCCGATTCGGACGCAGCCTCTCAGGAATTCGCCACGTTGCGAGAGGAGTTGGCCTGCCAACT
GGAAACCAGCGGCGTGGAAGCGGTGTTGCTCAGGCTGCAGGGCATGCAGGCGGACTTCCGCAGCCTGCGT
GAGCGCTGCCATACCACGGTGATCGCGGCTGATCTGCTGGCTGCTCGGGGCGTGTCCTGGTTGGCCCAGG
ACTTGTGCGCAGGCGTTGCCCGAACGATGCAGGAAACCACCGCCAGCGCCTGGGAGCCTGCGGTGTTTCA
ACGCCTTCAGCAGTACGCGTGCACGGTCCATCAAGGGCTGATTGGAACAAGGAACGGGAGTCAGGATGAA
TCAACTGTGGAAGCATCTTAA