SecReT6
Protein ID: 431803405
SecReT6 ID716
T6SS typei1
Gene symbol-
Locus tagB479_17365
StrainPseudomonas putida HB3267
Repliconchromosome [GenBank: NC_019905] [Browse all T6SS(s) in this replicon]
Location [Strand]3817075..3817578 [+]
Producthypothetical protein
NoteTssB
UniProt IDL0FNY2
KEGG IDppuh:B479_17365
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.00E-54, Aligned region: 6..158
Protein Sequence: 167 a.a.     [Download]
>gi|431803405|ref|YP_007230308.1| hypothetical protein B479_17365 [Pseudomonas putida HB3267]
MNKSSGSVAPKERINIKYVPATDGEQAEVELPHKMLVLGDFGLDDARALEDRSIMRIDKHSFNNVLNDAD
VSLAMSVPSMLSTAPDAELAVNLQFKSINDFGPDSIARQVPELNKLLELREALVALKGPLGNVPTFRKQL
QHLLNNEQARKQLAEELDLVLEAPKED
 
Nucleotide Sequence: 504 bp     [Download]
>gi|431799958|ref|NC_019905.1|:3817075-3817578 Pseudomonas putida HB3267, complete genome
ATGAATAAAAGCTCAGGCTCCGTTGCACCCAAAGAACGCATAAACATCAAGTACGTACCGGCCACCGACG
GCGAACAAGCCGAGGTAGAGCTGCCGCACAAGATGTTGGTACTAGGCGATTTCGGCCTGGATGATGCCCG
CGCGCTGGAAGACCGTTCGATCATGCGAATCGACAAACACAGTTTCAACAATGTGTTGAACGACGCCGAT
GTCAGCCTCGCCATGTCCGTGCCATCCATGCTCAGCACTGCCCCCGACGCAGAGCTGGCGGTCAACCTGC
AGTTCAAGTCCATCAACGATTTCGGGCCAGACAGCATCGCCCGCCAGGTACCGGAGCTGAACAAGCTGCT
GGAGCTTCGCGAGGCATTGGTCGCGCTGAAAGGCCCACTGGGCAACGTGCCCACGTTCCGCAAGCAACTG
CAGCACCTGCTGAATAACGAACAGGCACGCAAACAACTGGCTGAAGAACTTGACCTGGTGCTCGAGGCGC
CAAAAGAAGACTGA