SecReT6
Protein ID: 431803406
SecReT6 ID716
T6SS typei1
Gene symbol-
Locus tagB479_17370
StrainPseudomonas putida HB3267
Repliconchromosome [GenBank: NC_019905] [Browse all T6SS(s) in this replicon]
Location [Strand]3817596..3819086 [+]
Producthypothetical protein
NoteTssC
UniProt IDL0FNN8
KEGG IDppuh:B479_17370
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.60E-184, Aligned region: 69..494
Protein Sequence: 496 a.a.     [Download]
>gi|431803406|ref|YP_007230309.1| hypothetical protein B479_17370 [Pseudomonas putida HB3267]
MPKQNSTTVAVETTTEPLSNATLLDQIMAETKLAPTQEGYQVARQGVSAFIAEILKSHDPDQLINKHRVD
QMIAELDRVLSKQMDAILHQPKFQQLESAWRSLKLLVDRTDFRENIKLEVLHVSKDDLLDDFENAADITC
SGIYKHVYTAGYGQFGGEPVAAMVGNYSFGPSSPDIKLLSYMASVGAMAHAPFLAAPSPEFFNLSSFEEL
PNLKEIKDIFAGPRHAKWRAFRESEDARHTGLTGPRFMLRSAYHPQENPVQSFTYDEDIAGQHDNYLWGN
SAFLLASCINDSFARYRWCPNIIGPQSGGAVEDLPVHLYESLGQLQAKIPTEVLISDRKEFELAEEGFIA
LTMRKDSDNAAFFSANSVQKPKNFPKTPEGLQAQTNYKLGTQLPYLFIVNRLAHYIKVLQREQIGSWKER
KDLESELNKWIRQYVADQENPSADVRSRRPLRAARVEVSDVAGDPGWYQVSLAVRPHFKYMGANFEISLV
GRLDTQ
 
Nucleotide Sequence: 1491 bp     [Download]
>gi|431799958|ref|NC_019905.1|:3817596-3819086 Pseudomonas putida HB3267, complete genome
ATGCCAAAGCAAAACAGCACGACCGTCGCGGTTGAAACAACAACCGAACCACTGAGCAACGCCACCCTGC
TCGACCAGATCATGGCAGAAACCAAGTTGGCACCTACTCAAGAGGGCTATCAAGTCGCTCGCCAGGGTGT
ATCTGCTTTTATTGCCGAGATCCTTAAAAGCCATGACCCTGATCAACTCATCAACAAACATCGTGTCGAC
CAGATGATCGCTGAACTGGATCGAGTGCTCAGCAAGCAGATGGATGCCATCCTGCATCAACCCAAGTTTC
AGCAACTTGAATCCGCGTGGCGCAGCCTCAAACTTTTGGTCGACCGAACCGACTTTCGTGAGAACATCAA
GCTTGAAGTCTTGCATGTCAGCAAAGATGACTTGCTCGATGACTTCGAGAATGCCGCCGACATCACTTGC
AGCGGCATATACAAGCATGTTTACACCGCAGGTTATGGCCAATTTGGTGGTGAACCCGTTGCTGCGATGG
TTGGCAACTACAGCTTCGGCCCCTCTTCTCCCGATATAAAACTGCTGAGTTACATGGCCTCGGTCGGTGC
CATGGCACACGCACCTTTTCTCGCGGCGCCCTCTCCTGAGTTCTTCAATCTGAGCAGCTTTGAAGAACTG
CCCAATCTGAAGGAGATCAAGGACATTTTCGCCGGCCCCCGGCATGCCAAGTGGCGTGCGTTCCGCGAAA
GCGAGGATGCCCGTCATACCGGGCTGACCGGGCCGCGATTCATGCTCCGCTCTGCCTATCACCCGCAAGA
AAACCCGGTCCAGAGCTTCACCTACGACGAGGACATCGCCGGGCAGCACGACAACTATCTGTGGGGCAAC
TCCGCCTTCCTGCTGGCCAGCTGCATCAATGACAGCTTTGCCCGCTACCGCTGGTGCCCGAACATCATCG
GCCCGCAGTCGGGTGGTGCCGTCGAGGACCTGCCGGTGCACCTGTACGAGTCACTGGGTCAGCTGCAGGC
CAAGATTCCGACCGAAGTCCTGATCTCCGACCGCAAGGAGTTCGAGCTGGCCGAAGAGGGCTTCATCGCC
CTGACCATGCGCAAGGACAGCGACAACGCCGCGTTCTTCTCGGCCAACTCGGTACAGAAGCCGAAGAACT
TCCCCAAGACCCCGGAAGGCCTGCAAGCGCAAACCAACTACAAGCTCGGCACCCAGCTGCCCTACCTGTT
CATCGTCAACCGGCTGGCCCACTACATCAAGGTGCTGCAGCGCGAACAGATCGGTAGCTGGAAAGAGCGC
AAGGACCTTGAGTCCGAACTGAACAAATGGATCAGGCAGTACGTGGCCGACCAGGAGAACCCGTCAGCCG
ATGTGCGCAGCCGCCGCCCGTTGCGTGCTGCAAGGGTCGAGGTGTCGGACGTTGCCGGTGACCCGGGTTG
GTATCAGGTCTCGCTCGCCGTGCGCCCGCACTTCAAGTACATGGGGGCGAATTTCGAGATCTCCCTGGTC
GGCCGGCTTGATACCCAATGA