SecReT6
Protein ID: 431803407
SecReT6 ID716
T6SS typei1
Gene symbol-
Locus tagB479_17375
StrainPseudomonas putida HB3267
Repliconchromosome [GenBank: NC_019905] [Browse all T6SS(s) in this replicon]
Location [Strand]3819083..3819307 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDL0FM43
KEGG IDppuh:B479_17375
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.50E-23, Aligned region: 12..72
Protein Sequence: 74 a.a.     [Download]
>gi|431803407|ref|YP_007230310.1| type VI secretion protein [Pseudomonas putida HB3267]
MSGFFDRLVTDPGIPLVPLPVAPRDLPFHAGFTYFELDRRSPAWAGMEASSGFGIHVAGEFPGLELQFWA
IRSE
 
Nucleotide Sequence: 225 bp     [Download]
>gi|431799958|ref|NC_019905.1|:3819083-3819307 Pseudomonas putida HB3267, complete genome
ATGAGTGGATTTTTCGACCGTTTGGTGACGGATCCGGGGATTCCACTGGTGCCGCTGCCCGTGGCACCTC
GGGATCTGCCCTTCCATGCAGGCTTCACCTACTTCGAGCTGGACCGTCGTTCCCCGGCTTGGGCGGGCAT
GGAGGCATCCAGTGGCTTCGGTATCCACGTCGCGGGGGAGTTCCCGGGGCTGGAACTGCAGTTCTGGGCG
ATCAGGAGCGAATGA