SecReT6
Protein ID: 431803408
SecReT6 ID716
T6SS typei1
Gene symbol-
Locus tagB479_17380
StrainPseudomonas putida HB3267
Repliconchromosome [GenBank: NC_019905] [Browse all T6SS(s) in this replicon]
Location [Strand]3819309..3820193 [+]
Producthypothetical protein
NoteTssL
UniProt IDL0FMW0
KEGG IDppuh:B479_17380
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.00E-59, Aligned region: 67..259
Protein Sequence: 294 a.a.     [Download]
>gi|431803408|ref|YP_007230311.1| hypothetical protein B479_17380 [Pseudomonas putida HB3267]
MKQENSPPTDAEQVESEQLHAMLEASLSNDSPAPTAADGPERTPKAEPVYEGYPADPDFQLRGGYDNLML
DAAAPLFGLVIRLRTLDALPNIKDVHQQVRNQIENVREEMRQHGYEPAQLLAYSYGLCLFIDEAVMDRPW
GKTSCWSQEPLLSIFHDETWGGEKVFTVLSRLMQEPIRYQDVLEFMYFALCLGLKGKYAIAPKGEESLNA
LIHQLHGIIRELRGPTPETVCDPYTNVAPSNFRMNRQWPWWSPLVISALPGCIDTVCSGPVGPAPTANCH
EHRSRSAGYVLLRL
 
Nucleotide Sequence: 885 bp     [Download]
>gi|431799958|ref|NC_019905.1|:3819309-3820193 Pseudomonas putida HB3267, complete genome
ATGAAACAAGAAAACAGCCCCCCAACTGATGCCGAACAGGTCGAAAGCGAGCAACTGCACGCGATGCTCG
AGGCGTCATTGTCCAACGACTCACCCGCACCAACAGCGGCTGATGGCCCTGAGCGAACGCCAAAGGCAGA
GCCGGTGTATGAAGGCTACCCGGCAGACCCAGACTTCCAGCTACGTGGCGGCTACGACAACCTGATGCTG
GATGCCGCCGCCCCTCTATTCGGCCTGGTGATACGCCTGCGTACCCTAGATGCCTTGCCCAACATCAAGG
ACGTGCATCAGCAAGTGCGTAACCAGATCGAAAACGTGCGGGAAGAGATGCGCCAGCACGGCTACGAGCC
CGCTCAGTTGCTGGCGTACTCATACGGTCTTTGCCTTTTCATCGATGAAGCTGTCATGGACAGGCCTTGG
GGTAAAACCAGCTGCTGGAGCCAGGAACCCCTGCTCAGCATTTTCCACGACGAAACTTGGGGTGGAGAGA
AAGTCTTCACCGTACTGTCGCGCCTCATGCAGGAACCCATACGTTATCAGGACGTGCTGGAGTTCATGTA
CTTCGCGCTGTGCCTTGGTTTGAAAGGCAAGTACGCCATCGCCCCGAAGGGCGAAGAATCCCTCAACGCA
CTGATACACCAACTCCACGGGATTATCCGAGAACTGCGCGGCCCGACTCCGGAGACCGTCTGCGACCCAT
ACACCAACGTCGCCCCAAGCAACTTCCGCATGAACCGGCAATGGCCGTGGTGGAGTCCGTTGGTCATTTC
CGCCCTTCCGGGTTGTATTGATACTGTGTGCTCCGGCCCAGTGGGTCCTGCTCCCACAGCAAATTGCCAT
GAGCATCGTAGCCGTAGCGCCGGGTACGTCCTGCTCCGTCTGTGA