SecReT6
Protein ID: 431925332
SecReT6 ID717
T6SS typei1
Gene symbol-
Locus tagPsest_0123
StrainPseudomonas stutzeri RCH2
Repliconchromosome [GenBank: NC_019936] [Browse all T6SS(s) in this replicon]
Location [Strand]118402..120501 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDL0GFD4
KEGG IDpsh:Psest_0123
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.00E-72, Aligned region: 29..323
Phage_base_V [PF04717], Evalue: 4.90E-25, Aligned region: 371..464
Protein Sequence: 699 a.a.     [Download]
>gi|431925332|ref|YP_007238366.1| Rhs element Vgr protein [Pseudomonas stutzeri RCH2]
MFNPANQAHFTLSLEGVEHDFKVLEFQGREAISQPYRFDLELVSERSDLDLESLLHRPAFLALAPDGSGI
HGLVHQAAQGESGQRLTRYRLTLVPQLAYLAHRTNQRIFQHLTVPQIIAQVLEEHGIQADAYRFQLGPVI
YPPREYCVQYDESDLHFIQRLCEEEGIHYHFQHSAAGHALVFGDDQTVFPRLAATAYQQDSGLVADQPVI
KRFGLRLETRTSRVTRRDYDFEKPRLTMEASFHSDFQPDLEDYDYPGRFTERARGKHLSQRALERHRHDY
ELAEGESDQPRLASGHFLPLGEHPRSDWNQLWLLTEVLHEGKQPQVLEESVTSHVDTGDGFIQGYRNHFI
ATPWDIPFRPALKHPKPKVLGSQTAVVTGPVGEEIHCDEYGRVRVQFHWDREGQADDKTSCWLRVSSSWA
GGRYGGIAIPRVGMEVLVTFLEGDPDQPLVTGCLYHKDHQVPYDLPANKTRTVFKTLSSPGGGGYNELRI
EDRKGAEQIYLHAQRDWDENIEHDQKIRVGHERHDTVEANSYSEFKAEEHRTTHADRKTEIRANDHLTVG
NSQHLKIGTGQFIEAGNEIHYYAGSKVVIDAGMELTASGGGSFLKLDPSGVTLSGATIRMNSGGAAGKGS
GLKILAPVLPWLATSAVAGSLTLPALINMSRQLKQAAAAKLLLVKQCGMQADGSCQLEVCPCGKNASTV
 
Nucleotide Sequence: 2100 bp     [Download]
>gi|431925209|ref|NC_019936.1|:c120501-118402 Pseudomonas stutzeri RCH2 chromosome, complete genome
ATGTTCAACCCCGCCAACCAGGCCCACTTCACACTTTCCCTCGAAGGCGTCGAGCACGACTTCAAGGTGC
TCGAATTCCAGGGCCGCGAGGCCATCAGCCAGCCCTATCGTTTCGACCTGGAACTGGTCAGCGAGCGCTC
CGACCTGGATCTGGAAAGCCTGCTGCATCGCCCGGCCTTCCTCGCCTTGGCGCCGGACGGCAGCGGTATT
CATGGGCTGGTACATCAGGCCGCTCAGGGTGAATCCGGCCAGCGCCTGACCCGCTATCGGCTCACGCTCG
TGCCGCAGCTGGCCTATCTTGCCCATCGCACCAACCAGCGCATCTTCCAGCACCTGACGGTGCCGCAGAT
CATCGCCCAGGTGCTCGAGGAGCATGGCATCCAGGCCGATGCCTACCGCTTCCAGCTCGGCCCGGTGATC
TATCCGCCGCGCGAATATTGCGTGCAGTACGACGAATCGGACCTGCACTTCATCCAGCGCCTGTGCGAGG
AAGAGGGCATCCACTATCACTTCCAGCACAGCGCGGCCGGTCATGCCCTGGTCTTCGGCGACGACCAGAC
GGTCTTCCCCAGGCTCGCCGCCACCGCCTACCAGCAGGACAGCGGCCTGGTCGCCGACCAGCCGGTGATC
AAGCGCTTCGGCCTGCGCCTGGAAACCCGCACCAGCCGCGTCACGCGCCGCGATTACGATTTCGAAAAGC
CACGTCTGACCATGGAAGCCTCGTTCCACAGCGACTTCCAGCCCGACCTTGAAGATTACGATTACCCCGG
CCGCTTCACCGAGCGCGCCCGCGGCAAGCACCTGTCGCAACGCGCCCTGGAGCGCCACCGCCACGACTAC
GAACTGGCCGAAGGCGAAAGCGACCAGCCGCGACTGGCGAGCGGGCACTTCCTCCCGCTCGGCGAACACC
CCCGCAGCGACTGGAACCAGCTCTGGCTGCTGACCGAGGTGCTGCATGAAGGTAAGCAGCCACAGGTGCT
GGAGGAATCGGTCACCAGTCATGTTGATACCGGTGACGGCTTCATCCAGGGCTACCGCAACCACTTCATC
GCCACGCCCTGGGACATCCCCTTCCGCCCGGCTCTGAAGCATCCGAAACCGAAGGTGCTCGGCAGCCAGA
CCGCCGTGGTCACCGGCCCCGTCGGCGAAGAAATCCATTGCGACGAGTACGGTCGCGTACGCGTTCAATT
TCATTGGGATCGCGAAGGCCAGGCCGACGACAAGACCAGCTGCTGGCTGCGCGTCAGCTCCAGCTGGGCC
GGCGGCCGCTACGGCGGCATCGCGATCCCGCGCGTTGGCATGGAAGTGCTGGTGACCTTTCTCGAAGGCG
ACCCCGACCAACCGCTGGTGACCGGCTGTCTGTATCACAAGGACCACCAGGTTCCTTACGACCTGCCGGC
GAACAAGACCCGCACGGTGTTCAAGACCCTGAGCAGCCCGGGCGGTGGCGGCTACAACGAACTGCGCATC
GAAGACCGCAAGGGCGCCGAACAGATCTACCTCCACGCCCAGCGCGACTGGGACGAGAACATCGAGCACG
ACCAGAAGATCCGCGTCGGTCACGAACGCCACGACACGGTGGAAGCCAACAGCTACAGCGAATTCAAGGC
CGAAGAACACCGCACCACCCACGCCGATCGCAAGACCGAAATCCGCGCCAACGACCACCTCACCGTGGGC
AATAGCCAGCACCTGAAGATCGGCACCGGGCAATTCATCGAGGCGGGCAACGAAATCCACTACTACGCCG
GCAGCAAGGTCGTCATCGACGCTGGCATGGAACTCACCGCCTCCGGCGGCGGCAGTTTTCTCAAGCTCGA
CCCCAGCGGCGTGACGCTGAGCGGTGCGACGATCCGGATGAATTCGGGTGGCGCTGCCGGAAAGGGGTCG
GGGCTGAAGATTCTGGCGCCGGTATTGCCATGGCTGGCAACCAGCGCCGTTGCCGGCAGCCTCACCTTGC
CTGCCCTGATCAACATGTCGCGGCAACTCAAACAGGCCGCGGCCGCCAAGCTGCTGTTGGTCAAGCAGTG
CGGAATGCAAGCCGATGGCTCATGCCAGTTGGAGGTTTGCCCATGCGGCAAGAACGCGAGCACCGTCTGA