SecReT6
Protein ID: 431925334
SecReT6 ID717
T6SS typei1
Gene symbol-
Locus tagPsest_0125
StrainPseudomonas stutzeri RCH2
Repliconchromosome [GenBank: NC_019936] [Browse all T6SS(s) in this replicon]
Location [Strand]122036..124627 [-]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDL0GDC3
KEGG IDpsh:Psest_0125
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.20E-43, Aligned region: 206..227
AAA_2 [PF07724], Evalue: 1.20E-43, Aligned region: 597..762
AAA [PF00004], Evalue: 2.90E-19, Aligned region: 208..339
AAA [PF00004], Evalue: 2.90E-19, Aligned region: 602..720
AAA_5 [PF07728], Evalue: 1.30E-13, Aligned region: 208..228
AAA_5 [PF07728], Evalue: 1.30E-13, Aligned region: 283..338
AAA_5 [PF07728], Evalue: 1.30E-13, Aligned region: 458..518
AAA_5 [PF07728], Evalue: 1.30E-13, Aligned region: 601..720
AAA_16 [PF13191], Evalue: 6.00E-12, Aligned region: 185..228
AAA_16 [PF13191], Evalue: 6.00E-12, Aligned region: 252..286
AAA_16 [PF13191], Evalue: 6.00E-12, Aligned region: 572..625
AAA_16 [PF13191], Evalue: 6.00E-12, Aligned region: 666..695
AAA_16 [PF13191], Evalue: 6.00E-12, Aligned region: 756..841
AAA_22 [PF13401], Evalue: 2.00E-08, Aligned region: 207..303
AAA_22 [PF13401], Evalue: 2.00E-08, Aligned region: 600..706
ClpB_D2-small [PF10431], Evalue: 2.20E-08, Aligned region: 773..840
NACHT [PF05729], Evalue: 1.50E-05, Aligned region: 208..236
NACHT [PF05729], Evalue: 1.50E-05, Aligned region: 503..567
NACHT [PF05729], Evalue: 1.50E-05, Aligned region: 601..642
NACHT [PF05729], Evalue: 1.50E-05, Aligned region: 802..829
AAA_25 [PF13481], Evalue: 1.60E-05, Aligned region: 208..232
AAA_25 [PF13481], Evalue: 1.60E-05, Aligned region: 264..304
AAA_25 [PF13481], Evalue: 1.60E-05, Aligned region: 513..572
AAA_25 [PF13481], Evalue: 1.60E-05, Aligned region: 598..633
Sigma54_activat [PF00158], Evalue: 4.50E-05, Aligned region: 202..222
Sigma54_activat [PF00158], Evalue: 4.50E-05, Aligned region: 600..720
AAA_17 [PF13207], Evalue: 4.60E-05, Aligned region: 208..255
AAA_17 [PF13207], Evalue: 4.60E-05, Aligned region: 476..476
AAA_17 [PF13207], Evalue: 4.60E-05, Aligned region: 600..636
IstB_IS21 [PF01695], Evalue: 7.20E-05, Aligned region: 193..234
IstB_IS21 [PF01695], Evalue: 7.20E-05, Aligned region: 601..619
IstB_IS21 [PF01695], Evalue: 7.20E-05, Aligned region: 791..833
ResIII [PF04851], Evalue: 0.00043, Aligned region: 190..229
ResIII [PF04851], Evalue: 0.00043, Aligned region: 278..289
ResIII [PF04851], Evalue: 0.00043, Aligned region: 573..634
AAA_18 [PF13238], Evalue: 0.00046, Aligned region: 208..228
AAA_18 [PF13238], Evalue: 0.00046, Aligned region: 602..643
AAA_29 [PF13555], Evalue: 0.00057, Aligned region: 202..224
AAA_29 [PF13555], Evalue: 0.00057, Aligned region: 599..626
Clp_N [PF02861], Evalue: 0.00083, Aligned region: 31..72
Clp_N [PF02861], Evalue: 0.00083, Aligned region: 102..122
AAA_19 [PF13245], Evalue: 0.0018, Aligned region: 205..230
AAA_19 [PF13245], Evalue: 0.0018, Aligned region: 446..456
AAA_19 [PF13245], Evalue: 0.0018, Aligned region: 598..627
AAA_14 [PF13173], Evalue: 0.0029, Aligned region: 208..347
AAA_14 [PF13173], Evalue: 0.0029, Aligned region: 600..695
DUF258 [PF03193], Evalue: 0.003, Aligned region: 175..225
DUF258 [PF03193], Evalue: 0.003, Aligned region: 600..612
Arch_ATPase [PF01637], Evalue: 0.0047, Aligned region: 188..222
Arch_ATPase [PF01637], Evalue: 0.0047, Aligned region: 260..292
Arch_ATPase [PF01637], Evalue: 0.0047, Aligned region: 600..613
Arch_ATPase [PF01637], Evalue: 0.0047, Aligned region: 672..682
SRP54 [PF00448], Evalue: 0.0097, Aligned region: 208..229
SRP54 [PF00448], Evalue: 0.0097, Aligned region: 600..622
Protein Sequence: 863 a.a.     [Download]
>gi|431925334|ref|YP_007238368.1| type VI secretion ATPase, ClpV1 family [Pseudomonas stutzeri RCH2]
MINVDLQQLVQALDAETKRDLEGAAERCVVRGGSKILVEDLLLGLLERSDGLLKRALLDAEVDAGALAQA
LQPRGEHSESRNPVFSTELVQWLQDALLVASLELGQSQIDQAALILALLRNPLRYAGSHYQPLLARLDAE
RLRDFALSQQPQGSTGKPAAGGESNLARFTHNFTQQARDGKLDPVLCRDSAIRQMIDILARRRKNNPIVV
GEAGVGKTAIVEGLALRIASGEVPATLKGVELLCLDLGLLQAGASVKGEFERRLQGVIDEVKASPKPIIL
FIDEAHTLIGAGGQAGSGDAANLLKPALARGELRTIAATTWSEYKKYFEKDPALARRFQPVQLHEPSVQE
AVTILRGLAPVYEKSHGIYLRDDAVAAAAELSARYLAGRQLPDKAVDVLDTACARVRISLAAAPEALERL
RGEVAEGERQREAMRRDLAVGLPVDAAALERLEQRLIAAGDEIEQLETRWAKQRLLAERLLDLRKRTAEA
RSAANEDGEVPSLDELETELRAVQAELAAAQAKQRLVSHEVCPRLVAEVISHWTGVPLAQLAREHNAQVA
NFAADLRARVRGQEQAVEALDRAMRAAAAGLNKPDAPVGVFLLVGPSGVGKTETALALADLLYGGERFLT
VINMSEFQEKHSVSRLIGAPPGYVGYGEGGMLTEAVRQKPYSVILLDEVEKADPDVMNVFYQIFDKGVAN
DGEGREINFRNTLILMTSNLASERIASFCTAGQRPTAEDLELAIRPQLSQHFKPALLGRMRVVPYYPIAG
AVLDELVALKLVRFGERLQRRQLQFSHCPALVTHLSERCDDSDSGARLIDHLIEQHLQPLVVDRLLDAMA
SGEPLQQVHATLNGDGALVCEFA
 
Nucleotide Sequence: 2592 bp     [Download]
>gi|431925209|ref|NC_019936.1|:c124627-122036 Pseudomonas stutzeri RCH2 chromosome, complete genome
ATGATCAACGTCGATCTGCAACAGCTGGTACAGGCGCTGGACGCCGAGACCAAGCGCGATCTGGAAGGCG
CCGCCGAACGCTGCGTGGTGCGTGGCGGCAGCAAGATTCTCGTCGAGGACCTGCTGCTTGGCCTGCTCGA
GCGTTCCGATGGATTGCTCAAGCGAGCCTTGCTGGATGCCGAGGTGGACGCCGGCGCACTGGCTCAGGCG
CTGCAGCCGCGAGGCGAGCACAGCGAGTCGCGCAACCCGGTGTTCTCCACCGAACTGGTGCAATGGCTGC
AGGATGCCCTGCTGGTGGCGAGCCTGGAGCTGGGGCAGAGCCAGATCGACCAGGCTGCGCTGATCCTCGC
GCTGCTGCGCAATCCGCTGCGCTATGCAGGCAGCCATTACCAGCCACTGCTGGCCCGGCTGGATGCCGAG
CGCCTGCGCGACTTCGCTCTCAGCCAGCAGCCGCAAGGCAGCACGGGCAAACCTGCCGCCGGTGGCGAAT
CCAACCTGGCGCGCTTTACCCACAACTTCACCCAGCAGGCCCGCGACGGCAAGCTCGACCCGGTGCTCTG
CCGCGACTCGGCAATCCGCCAGATGATCGACATCCTTGCCCGGCGGCGGAAGAACAATCCGATCGTGGTC
GGCGAGGCCGGGGTCGGCAAGACCGCCATCGTCGAAGGCCTGGCGCTGCGCATCGCCAGCGGGGAAGTGC
CTGCGACACTCAAGGGCGTCGAGCTGCTCTGCCTCGACCTCGGCCTGCTGCAGGCCGGTGCCAGCGTGAA
GGGCGAATTCGAACGCCGTCTGCAGGGCGTTATCGACGAAGTGAAAGCCTCACCCAAGCCGATCATCCTG
TTCATCGATGAGGCGCACACCCTGATCGGCGCCGGTGGCCAGGCCGGCAGTGGCGATGCGGCCAACCTGC
TCAAGCCGGCCCTGGCACGCGGCGAGCTGCGCACCATCGCTGCGACGACCTGGAGCGAGTACAAGAAATA
TTTCGAGAAGGACCCGGCCCTGGCCCGGCGCTTCCAGCCGGTGCAATTGCACGAGCCGAGCGTTCAGGAA
GCCGTCACCATTCTGCGCGGGCTGGCGCCGGTCTATGAAAAGAGCCACGGCATCTACCTGCGCGACGATG
CGGTCGCGGCCGCCGCCGAGCTATCGGCTCGCTACCTAGCTGGCCGACAGCTGCCGGACAAAGCAGTGGA
CGTACTGGATACCGCCTGCGCACGGGTGCGCATCAGCCTCGCCGCCGCGCCCGAGGCGCTGGAACGCCTG
CGTGGCGAGGTCGCCGAAGGCGAGCGTCAACGTGAAGCCATGCGCCGCGATCTGGCCGTCGGCCTGCCGG
TCGACGCGGCCGCCCTCGAGCGGCTGGAGCAGCGCCTGATCGCGGCGGGGGACGAGATCGAGCAGCTGGA
AACCCGCTGGGCCAAGCAGCGCCTGCTCGCCGAGCGCCTGCTCGACCTGCGCAAGCGCACGGCCGAAGCC
CGCAGCGCTGCAAACGAGGACGGCGAGGTCCCATCGCTCGATGAGCTGGAGACCGAACTGCGCGCCGTAC
AGGCCGAACTTGCCGCAGCCCAGGCCAAGCAGCGACTGGTCAGCCATGAGGTCTGTCCGCGCCTGGTGGC
CGAGGTGATCAGCCACTGGACCGGTGTGCCGCTGGCGCAGCTGGCCCGTGAACACAACGCGCAGGTCGCC
AACTTCGCCGCCGACCTGCGCGCCCGCGTGCGCGGGCAGGAACAGGCTGTGGAAGCGCTGGATCGCGCCA
TGCGCGCGGCAGCGGCCGGGCTGAACAAGCCCGACGCTCCGGTGGGCGTGTTCCTGCTGGTCGGCCCCAG
CGGCGTCGGCAAGACCGAAACCGCCCTGGCGCTGGCCGACCTGCTGTACGGCGGCGAGCGCTTCCTCACC
GTGATCAATATGTCCGAGTTCCAGGAGAAGCACAGTGTTTCCCGCCTGATCGGCGCACCTCCGGGTTATG
TCGGCTACGGCGAAGGCGGCATGCTCACCGAAGCGGTGCGGCAGAAACCCTACTCGGTGATCCTGCTCGA
CGAGGTGGAGAAGGCCGATCCGGATGTGATGAACGTCTTCTATCAGATCTTCGACAAGGGCGTGGCGAAT
GACGGCGAAGGCCGCGAGATCAACTTCCGCAACACCCTGATCCTGATGACCAGCAACCTCGCCAGCGAGC
GCATCGCCAGTTTCTGCACCGCCGGGCAGCGGCCGACTGCCGAGGACCTGGAACTGGCGATACGCCCACA
GCTGTCGCAGCACTTCAAGCCGGCGCTGCTGGGGCGCATGCGGGTGGTCCCCTACTACCCTATCGCTGGC
GCGGTGCTCGACGAATTGGTCGCGCTCAAGCTTGTGCGCTTCGGTGAGCGGTTGCAGCGGCGCCAGCTGC
AGTTCAGCCATTGCCCGGCGCTGGTCACGCACCTTTCCGAGCGCTGCGACGACAGCGACAGCGGTGCGCG
CCTGATCGACCATCTGATCGAGCAGCACCTGCAACCGCTGGTGGTGGACCGTCTGCTCGATGCCATGGCC
AGTGGCGAGCCGCTGCAGCAGGTGCATGCCACGCTGAATGGCGACGGCGCGCTGGTCTGTGAGTTCGCCT
GA