SecReT6
Protein ID: 431925335
SecReT6 ID717
T6SS typei1
Gene symbol-
Locus tagPsest_0126
StrainPseudomonas stutzeri RCH2
Repliconchromosome [GenBank: NC_019936] [Browse all T6SS(s) in this replicon]
Location [Strand]124639..125646 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDL0GHE5
KEGG IDpsh:Psest_0126
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.20E-85, Aligned region: 19..321
Protein Sequence: 335 a.a.     [Download]
>gi|431925335|ref|YP_007238369.1| type VI secretion protein [Pseudomonas stutzeri RCH2]
MDAAHGSATAALKPLNRGIREYSLFQGVLLVLDRLRQLNPGLDDEALYERLEFQANPSLGFPGSDIEQVQ
FLQEHGEWRARLRINLVSLFGAGSPLPAFYGEQALGDSEDGNPTRDFLDLFNNRLQRLLLPIWQKYRYRA
RFTSGAHDPFSEQLFALVGLSGEAIRNAPELNWKRLLPYLGLLSLRAHSAALIESVLRYYFKHAELNIEQ
CLERQVEILGEQRNRLGQANSQLGESLVLGERVRDRGGKFRIHIRQLDWNRFHEFLPIGSGYQPLCALVR
FTLRDPLDYDLRLELRPDEIRELRIGADNNCRLGWTSWLGRERADGLVTLGSQTH
 
Nucleotide Sequence: 1008 bp     [Download]
>gi|431925209|ref|NC_019936.1|:c125646-124639 Pseudomonas stutzeri RCH2 chromosome, complete genome
ATGGACGCCGCGCATGGGTCAGCAACCGCTGCTCTGAAACCGCTCAACCGCGGCATCCGCGAGTACAGCC
TGTTCCAGGGCGTGCTGCTGGTGCTCGATCGCCTGCGCCAGCTCAATCCCGGCCTGGACGACGAGGCGCT
CTACGAGCGCCTGGAGTTTCAGGCCAACCCGAGCCTGGGCTTTCCCGGCAGCGATATCGAGCAGGTGCAG
TTCCTCCAGGAGCATGGCGAGTGGCGCGCGCGCCTGCGCATCAACCTGGTCAGCCTGTTCGGCGCCGGAT
CGCCGCTGCCAGCCTTCTATGGCGAACAGGCACTGGGCGACAGCGAGGACGGCAACCCGACCCGCGACTT
TCTCGACCTGTTCAACAATCGCCTGCAGCGCCTGCTGCTGCCGATCTGGCAGAAGTACCGCTACCGCGCC
CGCTTCACCAGCGGCGCCCATGACCCCTTCTCGGAGCAGCTGTTCGCCCTGGTCGGGCTCAGCGGCGAGG
CGATCCGCAACGCGCCGGAGCTGAACTGGAAGCGCCTGCTGCCCTATCTCGGCCTACTGAGCTTGCGCGC
GCACTCGGCGGCACTGATCGAATCGGTGCTGCGCTACTACTTCAAGCACGCCGAGCTGAACATTGAGCAA
TGTCTGGAGCGCCAGGTGGAAATCCTCGGCGAGCAACGCAACCGTCTCGGCCAGGCCAACAGCCAGCTGG
GCGAAAGCCTGGTGCTCGGCGAGCGGGTCCGCGACCGCGGCGGCAAATTCCGCATCCATATCCGCCAGCT
GGACTGGAACCGCTTCCACGAATTCCTCCCCATCGGCAGCGGCTACCAGCCGCTCTGTGCGCTGGTGCGC
TTCACCCTGCGCGATCCGCTGGATTACGACCTGCGCCTGGAGCTTCGCCCGGACGAGATCCGTGAACTGC
GCATCGGCGCCGACAACAACTGCCGCCTCGGCTGGACCAGCTGGCTCGGGCGTGAACGCGCCGACGGCCT
GGTCACCCTGGGCAGCCAGACTCATTAA