SecReT6
Protein ID: 431925336
SecReT6 ID717
T6SS typei1
Gene symbol-
Locus tagPsest_0127
StrainPseudomonas stutzeri RCH2
Repliconchromosome [GenBank: NC_019936] [Browse all T6SS(s) in this replicon]
Location [Strand]125610..127400 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDL0GH37
KEGG IDpsh:Psest_0127
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 5.00E-190, Aligned region: 3..596
Protein Sequence: 596 a.a.     [Download]
>gi|431925336|ref|YP_007238370.1| type VI secretion protein [Pseudomonas stutzeri RCH2]
MSFNHYYQSELTALRQLGKRFAERSPALAPFLGQAGRDPDVERLLEGFAFLTGRLRQKLDDELPELTHSL
MHLLWPNYMRPLPAFSMLQFDTLKRPGPALTVPRNTPVESNPVQGVSCCFRTAYATEVLPLALQALEYSV
KGTGALLSLRLQMSADGHLGEIGLSHLRLHLAGEPYISQLLYLSLLRHLGGIELVPLNEQGKPLTGSDGR
PLTPLQLNAKQVEPVGFAEDEALIPYPLNTFRGYRYLQEYFAFPDKFLFVDLKGLEVIQRIPEDLLKQAR
GLELRFDIHKAGVQRIRPTLDNVRLYCTPVVNLFPHDAIPIRLDGKQDQYLLLPAEYDTQQCGVFSVDRV
TGWKPGGMGYEEYVPFESFEHDASFDVPVARPHYSVRQQPSLLGEGQETWLSFGLRNLDQHETLSIELTC
TNQNLPRQLKLGDICKPSEDTPEFLSFRNISAVTPSYAPPLQRDYLWKLISNMSLNYLSLANVEALKVIL
ETYDLPRYYDKHAENVSRRRLGGLTHIAHQHVDRLHRGLPVRGVRTELTMNQDGFIGEGDLFLFASVLNE
FFALYASLNSYHELRVQSTQGEVYQWTPRMGQQPLL
 
Nucleotide Sequence: 1791 bp     [Download]
>gi|431925209|ref|NC_019936.1|:c127400-125610 Pseudomonas stutzeri RCH2 chromosome, complete genome
ATGTCTTTCAACCATTACTACCAGAGCGAACTGACCGCCCTGCGCCAACTAGGCAAGCGCTTCGCCGAGC
GCAGTCCGGCACTGGCGCCGTTCCTCGGGCAGGCCGGGCGCGACCCGGATGTCGAGCGTCTGCTCGAAGG
TTTCGCTTTTCTCACCGGGCGGCTGCGGCAGAAGCTCGATGACGAGCTGCCGGAGCTGACCCACTCGCTG
ATGCATCTGCTGTGGCCGAACTACATGCGCCCGCTGCCGGCCTTCAGCATGCTGCAGTTCGATACTTTGA
AACGACCCGGCCCGGCGCTGACGGTGCCGCGCAATACGCCGGTGGAATCCAATCCGGTGCAGGGCGTCAG
TTGCTGCTTTCGCACCGCCTACGCCACCGAGGTGCTGCCGCTGGCATTGCAGGCGCTGGAGTATTCGGTC
AAGGGCACCGGCGCGCTGCTCAGCCTGCGCCTGCAGATGAGCGCCGATGGCCATCTCGGCGAGATCGGAC
TCAGCCATCTGCGCCTGCATCTGGCGGGCGAGCCCTATATCAGCCAGCTGCTCTACCTCAGCCTGTTACG
CCACCTTGGCGGCATCGAGCTGGTGCCGCTGAACGAGCAGGGCAAACCGTTGACCGGCTCCGATGGCCGA
CCGCTGACGCCCTTGCAGCTCAACGCCAAGCAGGTCGAACCGGTGGGATTCGCCGAGGATGAGGCGCTGA
TCCCCTACCCGCTCAACACCTTCCGCGGCTATCGCTACCTGCAGGAATATTTCGCCTTCCCGGACAAGTT
CCTCTTCGTCGACCTCAAGGGTCTGGAGGTCATCCAGCGCATCCCCGAGGATCTGCTCAAGCAGGCCCGC
GGTCTGGAGCTGCGCTTCGACATTCACAAGGCCGGCGTGCAGCGCATACGTCCGACGCTGGACAACGTGC
GCCTGTACTGCACACCGGTGGTCAACCTGTTCCCGCACGATGCCATCCCGATCCGCCTGGACGGCAAGCA
GGACCAGTACCTGCTACTGCCAGCCGAGTACGATACGCAACAATGCGGCGTGTTCTCGGTGGATCGGGTG
ACCGGCTGGAAACCCGGCGGCATGGGCTACGAAGAATACGTGCCGTTCGAATCCTTCGAACATGACGCCA
GCTTCGATGTGCCGGTGGCCCGCCCGCACTACAGCGTGCGCCAGCAGCCTTCGCTGCTCGGAGAAGGGCA
GGAAACCTGGCTCAGCTTCGGCCTGCGCAACCTCGACCAGCACGAGACGCTGTCCATCGAGCTGACCTGC
ACCAACCAGAACCTGCCGCGCCAACTGAAGCTCGGCGACATCTGCAAGCCCAGCGAAGACACCCCGGAGT
TCCTCAGCTTCCGCAACATCTCGGCGGTCACCCCGAGCTACGCCCCTCCGCTGCAGCGCGACTATCTGTG
GAAGCTGATCAGCAACATGTCGCTGAACTACCTGTCGCTGGCCAACGTCGAGGCGCTCAAGGTGATCCTC
GAGACCTACGACCTGCCGCGCTATTACGACAAGCACGCCGAGAACGTCAGCCGGCGGCGCCTCGGCGGCC
TGACGCACATCGCCCACCAGCACGTCGATCGCCTGCATCGCGGGCTGCCGGTGCGCGGCGTACGCACCGA
ACTGACCATGAACCAGGACGGCTTCATCGGTGAGGGCGATCTGTTCCTCTTCGCCTCGGTGCTCAACGAA
TTCTTCGCTCTCTACGCCAGCCTCAACTCGTATCACGAGCTGCGCGTGCAGAGCACACAGGGAGAGGTGT
ACCAATGGACGCCGCGCATGGGTCAGCAACCGCTGCTCTGA