SecReT6
Protein ID: 431925339
SecReT6 ID717
T6SS typei1
Gene symbol-
Locus tagPsest_0130
StrainPseudomonas stutzeri RCH2
Repliconchromosome [GenBank: NC_019936] [Browse all T6SS(s) in this replicon]
Location [Strand]128434..130356 [-]
Producthypothetical protein
NotePAAR
UniProt IDL0GDC7
KEGG IDpsh:Psest_0130
PDB IDNA
Domain hit(s) vs Pfam DUF2235 [PF09994], Evalue: 1.70E-29, Aligned region: 169..455
PAAR_motif [PF05488], Evalue: 2.00E-17, Aligned region: 2..50
PAAR_motif [PF05488], Evalue: 2.00E-17, Aligned region: 58..83
Protein Sequence: 640 a.a.     [Download]
>gi|431925339|ref|YP_007238373.1| hypothetical protein Psest_0130 [Pseudomonas stutzeri RCH2]
MSGKPAARLGDPTACPKTGHGTNPIAVGSPDVLFDGLPAARQGDASACGGAMASAVIPNVLIDGKPAAVV
GSVGNHGNVVTAGSGTVIIGSGHSPAPFLAPEALGIATAAIAAATSAVKSLLPATPLARAWQEEPGDLAP
LGLEEEDEEEELVEQPQQQARQGITLRIGVFFDGTGNNLANAAVTEKCRRDDLTLLDERTLGEVVDYCRA
HGFGGSEGNGFFTQTPDNSYGNAPSNVAQLFDLYQDDATRSLAKDERSASIKAYLEGIGTSSGAADSIYG
QATGMGDTGVGARVIQSPNTIRVQLGLFAESNPNVQIDALEFDIFGFSRGAAAARHFANEVLKANGGVLA
ELLRPGQFGLSEDFEWSGQACINFIGLFDTVAAVVDPMGWDFSPADHLNRGINLYLPPGCARKVIQLTAR
DEMRWNFALNSVAPHHQEIALPGAHSDIGGGYLPIAREKLILSRPVSSTVPAGTPIESTHAWRETSRQYE
KWMALGLPEDQLKKEVRRIRKLNPRGVNHPPEDWVLGLVTIDRQIRGELALVYLRVMRELAVQQDVPFDF
IDERERAIALPKELQKIADKLMAFSKGGRYDLDKNEERLLRRNYIHLSANWKPSGGLLISKPAPNVRLIY
NNQPQQGYPE
 
Nucleotide Sequence: 1923 bp     [Download]
>gi|431925209|ref|NC_019936.1|:c130356-128434 Pseudomonas stutzeri RCH2 chromosome, complete genome
ATGTCCGGCAAACCCGCAGCCCGCCTGGGCGACCCCACAGCCTGTCCGAAGACAGGCCATGGCACCAACC
CCATTGCCGTCGGCTCACCCGACGTGCTGTTCGACGGCCTGCCGGCCGCGCGCCAAGGCGACGCCTCCGC
CTGCGGCGGTGCGATGGCCAGCGCGGTGATTCCCAACGTGCTGATTGATGGCAAACCAGCGGCGGTGGTG
GGCAGTGTGGGGAACCACGGCAATGTCGTCACCGCAGGCTCGGGGACGGTGATCATCGGCAGCGGTCACA
GCCCGGCGCCTTTCCTCGCACCCGAAGCGCTTGGCATTGCGACCGCTGCAATTGCTGCGGCAACCAGCGC
GGTCAAGTCCCTTCTTCCGGCCACACCGCTAGCCCGCGCCTGGCAGGAAGAGCCGGGGGACCTAGCGCCT
TTGGGCCTGGAAGAAGAAGACGAGGAAGAGGAACTGGTCGAGCAGCCGCAGCAACAGGCGCGCCAGGGCA
TCACCCTGCGAATCGGCGTGTTCTTCGACGGCACCGGCAACAACCTGGCCAATGCTGCCGTGACCGAAAA
GTGCCGCCGCGACGACCTGACATTGCTGGACGAGCGCACCCTTGGCGAAGTCGTCGACTACTGCCGGGCT
CATGGCTTCGGCGGCAGCGAAGGCAACGGTTTCTTCACCCAGACGCCCGACAACAGCTACGGCAACGCGC
CGAGCAACGTAGCGCAGTTGTTCGACCTGTACCAGGACGATGCGACCCGGAGCTTGGCGAAGGACGAGCG
TAGCGCCAGCATCAAGGCCTATCTCGAAGGCATCGGCACCAGCAGCGGTGCTGCGGACTCGATATACGGG
CAGGCTACAGGCATGGGCGATACCGGTGTGGGGGCTCGGGTGATCCAGAGCCCGAACACGATCCGCGTAC
AGCTGGGCCTATTTGCGGAAAGCAATCCCAACGTGCAGATCGACGCGCTGGAGTTCGATATTTTCGGATT
TAGCCGCGGTGCAGCAGCAGCCCGCCACTTCGCCAATGAGGTACTCAAAGCCAACGGTGGGGTGCTGGCT
GAGCTCCTGCGGCCAGGCCAGTTCGGTCTGTCAGAAGACTTCGAATGGAGCGGCCAGGCCTGCATCAACT
TTATCGGTCTGTTCGATACGGTGGCAGCAGTGGTCGACCCAATGGGGTGGGACTTCAGCCCTGCGGACCA
TCTCAATCGAGGCATCAACCTGTACCTGCCTCCGGGTTGCGCACGCAAGGTAATCCAGCTCACGGCTCGA
GATGAGATGCGCTGGAACTTCGCGCTCAATAGCGTGGCTCCGCATCACCAGGAGATAGCGCTTCCCGGCG
CGCACTCGGATATCGGTGGTGGCTATCTTCCGATTGCCCGGGAAAAGCTGATCTTGAGTCGTCCTGTCAG
CTCCACGGTGCCCGCTGGTACGCCTATTGAAAGCACGCACGCCTGGCGTGAAACCAGCCGTCAATACGAG
AAGTGGATGGCTCTCGGGCTACCGGAAGATCAGCTTAAAAAAGAGGTTCGCCGCATCCGCAAACTCAACC
CCCGCGGCGTCAACCATCCACCGGAGGACTGGGTATTAGGCCTGGTAACTATTGACCGTCAGATACGCGG
CGAGTTGGCGCTGGTGTATTTGCGTGTGATGCGGGAACTAGCAGTGCAGCAAGACGTTCCTTTCGACTTC
ATCGATGAAAGGGAAAGAGCAATCGCACTGCCCAAGGAGCTTCAGAAAATTGCCGATAAGCTGATGGCTT
TTTCCAAAGGAGGCCGTTACGACCTGGATAAAAATGAAGAACGCTTGCTTCGGAGAAACTACATCCACCT
GTCAGCGAACTGGAAGCCCTCTGGCGGTCTGCTTATCAGCAAGCCTGCACCCAACGTCCGTCTGATCTAC
AACAACCAGCCACAGCAAGGCTACCCCGAATGA