SecReT6
Protein ID: 431925340
SecReT6 ID717
T6SS typei1
Gene symbol-
Locus tagPsest_0131
StrainPseudomonas stutzeri RCH2
Repliconchromosome [GenBank: NC_019936] [Browse all T6SS(s) in this replicon]
Location [Strand]130368..130775 [-]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDL0GHF0
KEGG IDpsh:Psest_0131
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.80E-19, Aligned region: 25..114
Protein Sequence: 135 a.a.     [Download]
>gi|431925340|ref|YP_007238374.1| type VI secretion system lysozyme-like protein [Pseudomonas stutzeri RCH2]
MNGYGSLFERLGGDAARRSGWSREVAAMASVAAHLAKMLSTRAGSVQTLPDYGLPDLNDMRLSLHDSLQQ
ARIAIERFIEAYEPRLTRVRVLSLPRTHDPLSLAFTIEGLLEVDGLKRQVSFSASLDGSGQVKVQ
 
Nucleotide Sequence: 408 bp     [Download]
>gi|431925209|ref|NC_019936.1|:c130775-130368 Pseudomonas stutzeri RCH2 chromosome, complete genome
TTGAACGGATACGGCAGCCTTTTCGAACGCCTCGGCGGCGACGCCGCGCGGCGTTCCGGCTGGAGCCGCG
AAGTCGCGGCAATGGCCTCGGTGGCTGCCCATCTGGCCAAGATGCTCAGCACCCGGGCGGGCAGCGTGCA
GACGCTGCCCGACTACGGGTTGCCCGATCTCAACGATATGCGCCTGTCGCTGCACGACTCGCTGCAGCAG
GCGCGTATCGCCATCGAACGCTTCATCGAAGCGTACGAACCCAGGCTGACCCGGGTGCGGGTGCTGTCAC
TGCCGCGAACCCACGACCCACTGAGCCTCGCCTTCACCATTGAAGGCCTGCTGGAGGTCGATGGCCTCAA
GCGCCAGGTCAGCTTTTCCGCCAGCCTGGATGGCAGCGGACAGGTCAAGGTCCAGTAA