SecReT6
Protein ID: 431925341
SecReT6 ID717
T6SS typei1
Gene symbol-
Locus tagPsest_0132
StrainPseudomonas stutzeri RCH2
Repliconchromosome [GenBank: NC_019936] [Browse all T6SS(s) in this replicon]
Location [Strand]130780..132258 [-]
Producttype VI secretion protein EvpB
NoteTssC
UniProt IDL0GH43
KEGG IDpsh:Psest_0132
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 8.60E-192, Aligned region: 65..490
Protein Sequence: 492 a.a.     [Download]
>gi|431925341|ref|YP_007238375.1| type VI secretion protein EvpB [Pseudomonas stutzeri RCH2]
MTTSAAAVEHGNHLAEGGILDRIIAETRLTPDDEAYDIAKRGVSAFIEELLKPQNENEPVKKAMVDRMIA
EIDAKLSQQMDEILHHPQFQALESSWRGLKLLVDRTNFRENIKLELLNASKQDLLDDFEDSPEIVQSGLY
KHIYTAEYGQFGGQPVGALIANYFFDPSAPDVKTMQYVASVASMSHAPFIAAAGPKFFGLESFTGLPDLK
DLKDHFEGPQFTKWQSFREQEDARYVGLTVPRFLLRNPYDPEDNPVKSFVYKENVAGSHEHYLWGNTAYT
FASRLTDSFAKFRWCPNIIGPQSGGAVEDLPLHHFESMGEIETKIPTEVLVSDRREYELAEEGFIALTMR
KGSDNAAFFSANSAQKPKFFGNSEEGKTAELNYKLGTQLPYLFIVNRLAHYLKVLQREQIGAWKERTDLE
LELNKWIRQFVADQENPSSEVRSRRPLRAAQVNVSDVEGEPGWYRVSLSVRPHFKYMGADFTLSLVGKLD
KE
 
Nucleotide Sequence: 1479 bp     [Download]
>gi|431925209|ref|NC_019936.1|:c132258-130780 Pseudomonas stutzeri RCH2 chromosome, complete genome
ATGACCACTAGCGCAGCCGCCGTCGAGCACGGCAACCACCTCGCCGAAGGCGGCATCCTCGACCGCATCA
TCGCCGAAACCCGCCTGACCCCGGACGACGAGGCCTACGACATCGCCAAGCGCGGCGTCTCGGCCTTTAT
CGAAGAACTGCTCAAGCCGCAGAACGAAAACGAGCCGGTGAAGAAGGCCATGGTCGACCGCATGATCGCG
GAGATCGACGCCAAGCTCAGCCAGCAGATGGACGAGATCCTTCATCACCCGCAGTTCCAGGCGCTGGAAT
CCTCCTGGCGCGGCCTCAAGCTGCTGGTCGATCGCACCAACTTCCGCGAGAACATCAAGCTCGAGCTGCT
CAACGCCTCCAAGCAGGACCTGCTGGATGACTTCGAGGACAGCCCGGAGATCGTTCAGTCCGGCCTGTAC
AAGCACATCTACACCGCCGAGTACGGCCAGTTCGGTGGCCAGCCGGTCGGCGCACTGATCGCCAACTATT
TCTTCGACCCCAGCGCGCCCGACGTCAAGACCATGCAGTACGTCGCCAGCGTCGCCAGCATGTCCCACGC
GCCATTCATTGCCGCGGCCGGTCCGAAATTCTTCGGCCTGGAAAGCTTCACCGGCCTGCCGGACCTGAAG
GACCTCAAGGATCACTTCGAGGGCCCGCAGTTCACCAAGTGGCAGAGCTTCCGCGAGCAGGAGGATGCCC
GCTACGTCGGCCTGACCGTGCCGCGCTTCCTGCTGCGCAACCCCTACGATCCGGAAGACAACCCGGTGAA
GAGCTTCGTCTACAAGGAAAACGTCGCCGGCAGCCACGAGCACTACCTGTGGGGCAACACCGCCTACACC
TTCGCCAGCCGCCTGACCGACAGCTTCGCCAAGTTCCGCTGGTGCCCGAACATCATCGGCCCGCAGAGCG
GCGGCGCAGTGGAAGACCTGCCGCTGCACCACTTCGAGAGCATGGGCGAGATCGAGACCAAGATCCCGAC
CGAGGTGCTGGTTTCCGATCGCCGCGAGTACGAGCTGGCCGAGGAAGGCTTCATCGCCCTGACCATGCGC
AAGGGCAGCGACAACGCCGCGTTCTTCTCCGCCAACTCGGCGCAGAAGCCGAAGTTCTTCGGCAACAGCG
AGGAAGGCAAGACCGCCGAGCTGAACTACAAGCTCGGCACCCAGCTGCCCTACCTGTTCATCGTCAACCG
CCTGGCGCACTACCTGAAGGTGCTGCAGCGCGAGCAGATCGGCGCCTGGAAGGAGCGCACCGACCTCGAA
CTGGAACTGAACAAGTGGATCCGCCAGTTCGTCGCCGACCAGGAGAACCCGAGCTCCGAAGTACGTAGCC
GTCGTCCGCTGCGCGCCGCCCAGGTCAACGTCAGCGACGTCGAGGGCGAACCGGGCTGGTACCGCGTCAG
CCTCAGCGTGCGTCCGCACTTCAAGTACATGGGCGCGGATTTCACCCTGTCGCTGGTCGGCAAGCTGGAC
AAGGAATAA