SecReT6
Protein ID: 431925342
SecReT6 ID717
T6SS typei1
Gene symbol-
Locus tagPsest_0133
StrainPseudomonas stutzeri RCH2
Repliconchromosome [GenBank: NC_019936] [Browse all T6SS(s) in this replicon]
Location [Strand]132285..132791 [-]
Producttype VI secretion protein
NoteTssB
UniProt IDL0GFE1
KEGG IDpsh:Psest_0133
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.40E-55, Aligned region: 5..159
Protein Sequence: 168 a.a.     [Download]
>gi|431925342|ref|YP_007238376.1| type VI secretion protein [Pseudomonas stutzeri RCH2]
MAKEGSVAPKERINVTFKPATGNAQEEVELPLKLMVLGDFTQRADDRKIEDRKPIAIDKNSFDEVLAKQE
LNLTFGVPNRLQDEQTDDELAVQLRINSMKDFNPANLVEQVPELKKLMELRDALVALKGPLGNAPAFRKA
IESVLADDDSRDRVLGELGLAAKEKLDA
 
Nucleotide Sequence: 507 bp     [Download]
>gi|431925209|ref|NC_019936.1|:c132791-132285 Pseudomonas stutzeri RCH2 chromosome, complete genome
ATGGCCAAAGAAGGCTCGGTTGCACCCAAGGAACGCATCAACGTCACGTTCAAGCCGGCCACCGGCAACG
CTCAGGAAGAGGTCGAGCTGCCCCTCAAGCTGATGGTGCTGGGCGACTTCACCCAGCGCGCCGACGACCG
CAAGATCGAGGACCGCAAGCCCATCGCCATCGACAAGAACAGCTTCGACGAGGTCCTGGCCAAGCAGGAG
CTGAACCTGACCTTCGGCGTGCCGAACCGTCTGCAGGACGAGCAGACCGACGACGAACTGGCCGTGCAGC
TGCGCATCAATTCGATGAAGGACTTCAACCCGGCCAATCTGGTCGAGCAGGTTCCGGAGCTGAAGAAACT
GATGGAACTGCGCGACGCCCTGGTCGCACTCAAGGGCCCGCTGGGCAATGCTCCGGCCTTCCGCAAGGCC
ATCGAAAGCGTACTCGCCGACGACGATTCGCGTGACCGCGTACTCGGCGAACTGGGCCTGGCGGCCAAAG
AGAAGCTGGACGCCTGA