SecReT6
Protein ID: 431925343
SecReT6 ID717
T6SS typei1
Gene symbol-
Locus tagPsest_0134
StrainPseudomonas stutzeri RCH2
Repliconchromosome [GenBank: NC_019936] [Browse all T6SS(s) in this replicon]
Location [Strand]132808..134370 [-]
Producttype VI secretion-associated protein
NoteTssA
UniProt IDL0GG55
KEGG IDpsh:Psest_0134
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.30E-20, Aligned region: 54..114
ImpA-rel_N [PF06812], Evalue: 1.30E-20, Aligned region: 146..163
Protein Sequence: 520 a.a.     [Download]
>gi|431925343|ref|YP_007238377.1| type VI secretion-associated protein [Pseudomonas stutzeri RCH2]
MHASALSKHYLELARKPVNDSNFAGDDIRYSSEFELLETELAKAGALHQTTGIDWQKVREGSEMLLTSLS
KDLRAAAWLTWSLFQRESFAGLQAGLSVLQYLCSNHWAELHPRKPRTRAAAINWLLPRLEQTFSEDVPVG
EQLPLFRGLAEQLHALEQCLSGHLGEDAPLLLPLCRQLDGMVKRASQGQAQPGTVGAAIAQVKQVASQVF
APGSPIENDKEALKAVRNLQEQARPLTAWWLKQRTSDLRPLRLSRTLLWLSIDSLPEHNGEQVTALRGIP
ADKLANYRERFAQGLYADLLVDLENSTARAPFWLDGQRLAWECLQELAAEQAMREVEIQLALFLQRLPRL
EELRFHDGIPFADAETRAWISGQVMPHVQRAATTRQEEPPAAGSVQPSWELALQEALPLLRKEGLKPAVQ
QLKQGLARARGGRERFFWQLSLARLCYQAKKYELAKTQLEALDQQLEASGLGSWEPDLALEVLRLLHSCC
ELLPQNHAVRESKDEIYRRLCHLDLEVVLD
 
Nucleotide Sequence: 1563 bp     [Download]
>gi|431925209|ref|NC_019936.1|:c134370-132808 Pseudomonas stutzeri RCH2 chromosome, complete genome
ATGCACGCCAGCGCACTCAGCAAGCATTATCTGGAACTTGCCAGAAAACCGGTCAATGACAGCAATTTCG
CTGGCGACGATATTCGCTACAGCAGCGAGTTCGAACTGCTGGAAACCGAGCTGGCAAAGGCCGGGGCGCT
GCACCAGACCACCGGTATCGACTGGCAGAAGGTCCGCGAAGGCAGCGAGATGCTGCTCACCTCGCTGTCC
AAGGACCTGCGCGCCGCCGCCTGGCTGACCTGGAGCCTGTTCCAGCGTGAATCCTTCGCCGGTTTGCAGG
CCGGTCTAAGCGTTCTGCAGTACCTGTGCAGCAATCACTGGGCCGAGCTGCATCCGCGCAAGCCACGCAC
CCGTGCCGCCGCGATCAACTGGTTGCTGCCGCGCCTGGAGCAGACCTTTTCCGAAGACGTCCCTGTCGGC
GAACAGCTACCGCTGTTCCGTGGCCTCGCCGAGCAGCTGCACGCACTGGAACAATGCCTGTCCGGCCATC
TGGGCGAAGACGCACCGCTGCTGCTGCCGCTGTGCCGCCAACTCGACGGCATGGTCAAGCGCGCCAGTCA
GGGGCAGGCCCAGCCCGGGACGGTCGGCGCGGCTATCGCCCAGGTGAAGCAGGTCGCCAGCCAGGTCTTC
GCCCCCGGCTCACCGATCGAAAATGACAAGGAAGCGCTCAAGGCGGTGCGCAACCTGCAGGAACAGGCGC
GCCCGCTGACGGCCTGGTGGCTCAAGCAGCGCACCAGCGATCTGCGCCCGCTGCGCCTCTCACGCACCCT
GCTCTGGCTGAGTATCGACAGCCTGCCGGAGCACAACGGCGAGCAGGTCACCGCCCTGCGTGGGATACCT
GCCGACAAGCTGGCCAACTACCGCGAACGCTTCGCCCAGGGTCTGTACGCGGACCTGCTGGTGGATCTGG
AGAACAGCACCGCGCGTGCCCCGTTCTGGCTGGACGGCCAGCGCCTGGCCTGGGAGTGCCTGCAGGAGCT
GGCGGCCGAACAGGCCATGCGCGAAGTGGAGATTCAGCTCGCGCTGTTCCTGCAGCGGCTGCCGCGCCTG
GAGGAGCTGCGCTTTCACGACGGCATCCCGTTCGCCGATGCCGAAACCCGCGCCTGGATCAGCGGCCAGG
TCATGCCCCATGTGCAGCGTGCCGCCACCACAAGACAGGAAGAGCCGCCTGCTGCTGGCAGCGTGCAGCC
GAGCTGGGAGCTGGCATTGCAGGAAGCGCTGCCGCTGTTGCGCAAGGAGGGGCTCAAACCTGCCGTGCAG
CAGCTCAAGCAGGGCCTGGCTCGCGCCCGTGGCGGCCGCGAGCGCTTCTTCTGGCAGCTGAGCCTCGCCC
GCCTTTGCTACCAGGCGAAGAAATACGAGCTGGCCAAAACCCAGCTCGAAGCACTCGACCAGCAGCTTGA
GGCCAGCGGCCTGGGCAGCTGGGAACCCGATCTCGCCCTCGAGGTACTGCGCCTGCTGCACAGCTGTTGC
GAGCTGCTGCCGCAGAACCACGCCGTGCGTGAAAGCAAGGATGAGATTTACCGCAGGCTGTGCCACCTCG
ATCTCGAAGTGGTGCTGGATTAA