SecReT6
Protein ID: 431929307
SecReT6 ID718
T6SS typeN/A
Gene symbol-
Locus tagPsest_4242
StrainPseudomonas stutzeri RCH2
Repliconchromosome [GenBank: NC_019936] [Browse all T6SS(s) in this replicon]
Location [Strand]4424609..4425805 [+]
Producttype VI secretion system FHA domain-containing protein
NoteFha
UniProt IDL0GRR9
KEGG IDpsh:Psest_4242
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 2.00E-12, Aligned region: 29..97
Protein Sequence: 398 a.a.     [Download]
>gi|431929307|ref|YP_007242341.1| type VI secretion system FHA domain-containing protein [Pseudomonas stutzeri RCH2]
MELVFDMVGAQQFVPGLLTTKTFKQAGGVIGRAEGCDWVIPDRKRVLSGRHAVISYRDGGFFLTDTSSNG
IQLKDSGASLVKGQPQRIEHGSVYCLGDFEIRARLIQDPALFEGDIGRPQPAGTIIPDDAFLDLDPLVAM
DQQERIYAEVDDLDLTLVAPQRQAQQRDYARIDTESLPLPELVMPQVATEPKREPEPERLPPGFWQRFGD
ALGVDLKDMDEDQRQALALNAARLLKQSIGGLQQSLRTRSELKNELRLALTTVQSAGNNPLKHSADTGEA
MSALLRGGKPGQLTAEQAVGRAFRDLQAHQVALLAASRAAVQAMFEQLAPEQLALRFEREGRKPLLATAG
SRWRAYRRLHHSLGQDADWSERLFARDFAKTYEEQVRLIATLDSTHQG
 
Nucleotide Sequence: 1197 bp     [Download]
>gi|431925209|ref|NC_019936.1|:4424609-4425805 Pseudomonas stutzeri RCH2 chromosome, complete genome
ATGGAACTGGTCTTCGATATGGTGGGCGCCCAGCAATTCGTGCCCGGGCTGCTGACCACCAAAACCTTCA
AGCAGGCCGGCGGCGTGATCGGCCGGGCCGAAGGCTGCGATTGGGTGATCCCCGACCGCAAGCGCGTCCT
CTCCGGGCGTCACGCGGTGATCAGCTACCGCGACGGCGGCTTCTTTCTCACCGATACCAGCAGTAACGGC
ATCCAGCTCAAGGACAGCGGTGCCAGCCTGGTCAAGGGCCAGCCGCAGCGCATCGAGCATGGCAGCGTCT
ATTGCCTGGGCGACTTCGAGATCCGCGCCCGGCTGATCCAGGACCCGGCGCTGTTCGAAGGCGACATCGG
CCGCCCGCAACCTGCCGGCACCATCATTCCCGACGATGCCTTCCTCGACCTCGATCCACTGGTCGCGATG
GATCAGCAGGAGCGCATCTATGCCGAAGTCGACGACCTCGACCTGACGCTGGTGGCACCGCAACGCCAGG
CCCAGCAGCGCGACTACGCCCGCATCGACACCGAAAGCCTGCCGCTGCCGGAGCTGGTCATGCCGCAGGT
GGCAACCGAACCCAAGCGCGAACCGGAGCCCGAACGCCTGCCTCCCGGCTTCTGGCAGCGCTTCGGCGAC
GCGCTGGGTGTCGATCTCAAGGATATGGACGAGGACCAGCGTCAGGCGCTGGCACTGAATGCCGCGCGCC
TGCTCAAGCAGAGCATCGGCGGTTTGCAGCAGAGCCTGCGCACCCGTAGCGAGCTGAAGAACGAGCTGCG
CCTGGCACTGACCACCGTACAGAGCGCCGGCAACAACCCGCTCAAGCACAGCGCCGATACTGGCGAGGCC
ATGAGCGCCCTGCTGCGCGGTGGCAAGCCTGGCCAGCTCACGGCCGAGCAGGCCGTCGGTCGCGCCTTCC
GCGACCTGCAGGCGCATCAGGTGGCACTGCTGGCCGCCAGCCGCGCAGCGGTGCAGGCGATGTTCGAACA
ACTGGCCCCGGAGCAGCTGGCGCTGCGTTTCGAACGCGAAGGCCGCAAACCGCTGCTCGCCACCGCCGGC
AGTCGCTGGCGCGCCTATCGCCGGCTGCATCACAGCCTCGGCCAGGACGCCGACTGGAGCGAACGGCTGT
TCGCCCGCGATTTCGCCAAGACCTATGAGGAGCAGGTGCGCCTGATCGCCACGCTCGATTCCACCCATCA
AGGATGA