SecReT6
Protein ID: 431929309
SecReT6 ID718
T6SS typeN/A
Gene symbol-
Locus tagPsest_4244
StrainPseudomonas stutzeri RCH2
Repliconchromosome [GenBank: NC_019936] [Browse all T6SS(s) in this replicon]
Location [Strand]4426295..4427626 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDL0GPN3
KEGG IDpsh:Psest_4244
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 9.50E-148, Aligned region: 18..442
Protein Sequence: 443 a.a.     [Download]
>gi|431929309|ref|YP_007242343.1| type VI secretion protein [Pseudomonas stutzeri RCH2]
MSLHKVVWQEGMLLRPQHFQQSDRYYDHQLKARTQKLGSYAWGFFNLEIDRQFLNMGKLVLSQASGILPD
GTLFELGSEREPLALDIPPNTGSTPVYLALPLVTGNHIETRRPEQKDVLARYTAHELEVADSNAGDSSTS
QVSTGLPDFRLLLGEQQSDQAYVKLQLCEVLDTTPDGVISLDPEFIPTYVNFQASGYLLSCLKEVISMLA
HRGDTLAERISATGKVGGAEVGDFMMLQLINRHEPVLRHYLGVEQVHPEQIYRDLLGLLGELATFSSESK
RPRLDGRYQHSDQGASFRKLMDAIRQVLSMVLEQHAIELLLQQRQYGIQVSPLHDHKLLGTASFVLAASA
QCDSETLRTRLPAHLKIGPVERIRQLVNLHLPGIRLKPLPVAPRQIPFHAGKTYFALELSAEDQAQLERS
GGFAFHVSGDFTGLELKFWAVRD
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|431925209|ref|NC_019936.1|:4426295-4427626 Pseudomonas stutzeri RCH2 chromosome, complete genome
ATGAGCCTGCACAAGGTTGTCTGGCAGGAAGGCATGCTGCTGCGTCCGCAGCACTTCCAGCAGAGCGATC
GCTACTACGATCACCAACTCAAGGCGCGTACCCAGAAGCTGGGCAGCTACGCCTGGGGCTTCTTCAACCT
GGAGATCGACCGCCAGTTCCTCAACATGGGCAAGCTGGTACTCAGCCAGGCCAGCGGCATCCTCCCGGAC
GGTACGCTGTTCGAGCTGGGCAGCGAGCGCGAGCCACTGGCGCTGGACATCCCGCCGAACACAGGCAGCA
CACCGGTCTATCTCGCGTTGCCGCTGGTCACCGGCAACCACATCGAGACCCGCCGGCCCGAACAGAAGGA
CGTGCTGGCGCGTTATACCGCCCACGAACTGGAGGTCGCCGATTCCAATGCCGGCGACAGCAGCACCAGC
CAGGTGAGCACCGGCCTGCCGGATTTCCGCCTGCTGCTGGGCGAGCAGCAGAGCGACCAGGCCTACGTGA
AGCTGCAGCTGTGCGAGGTACTGGACACCACGCCGGACGGGGTCATCAGCCTCGACCCCGAGTTCATCCC
CACCTATGTCAACTTCCAGGCTTCCGGCTACCTGCTGTCGTGCCTGAAGGAAGTGATCAGCATGCTCGCC
CACCGCGGCGACACCCTCGCCGAGCGCATCAGCGCCACCGGCAAGGTGGGTGGCGCCGAGGTCGGCGACT
TCATGATGCTGCAGCTGATCAACCGTCACGAACCAGTGCTGCGCCACTACCTGGGCGTGGAGCAGGTGCA
TCCGGAGCAGATCTACCGCGACCTGCTTGGCCTGCTCGGCGAGCTGGCGACCTTCTCCAGCGAGAGCAAG
CGCCCGCGCCTGGATGGCCGTTACCAGCACAGCGACCAGGGCGCGAGCTTCCGCAAGCTGATGGACGCGA
TTCGCCAGGTGTTGTCGATGGTGCTCGAACAGCATGCCATCGAGCTGCTGCTGCAGCAGCGTCAGTACGG
CATCCAGGTATCGCCGCTGCATGACCACAAGCTGCTCGGCACGGCGTCTTTCGTGCTCGCCGCCAGCGCC
CAGTGCGACTCGGAAACCCTGCGCACGCGGCTGCCGGCGCACCTGAAGATCGGCCCGGTGGAGCGTATCC
GCCAGCTGGTCAACCTGCATCTGCCGGGCATCCGCCTCAAGCCGCTGCCGGTGGCGCCGCGGCAAATCCC
CTTCCATGCCGGCAAAACCTATTTCGCCCTGGAGCTCAGCGCCGAGGACCAGGCGCAGCTGGAGCGCTCC
GGCGGCTTTGCCTTCCATGTGTCCGGTGACTTCACCGGGCTCGAACTGAAATTCTGGGCGGTCAGGGACT
GA