SecReT6
Protein ID: 431929310
SecReT6 ID718
T6SS typeN/A
Gene symbol-
Locus tagPsest_4245
StrainPseudomonas stutzeri RCH2
Repliconchromosome [GenBank: NC_019936] [Browse all T6SS(s) in this replicon]
Location [Strand]4427632..4428513 [+]
ProductDotU family type IV / VI secretion system protein
NoteTssL
UniProt IDL0GTU1
KEGG IDpsh:Psest_4245
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.50E-71, Aligned region: 61..266
Protein Sequence: 293 a.a.     [Download]
>gi|431929310|ref|YP_007242344.1| DotU family type IV / VI secretion system protein [Pseudomonas stutzeri RCH2]
MIKEMDYGQDDRTVIVNRAGETPAQSPLTDFDTPPRFEQLEERMIYAARLRPAETFNISLNPLVAAASPL
LSEVVRFKHSLESEDLQALHGQLSSAIKLFEHRALHDGAESSQVMAARYVLCTVLDEAVVTTPWGNESEW
SQMSLLSSFHNETFGGEKFFQLLERLSRNPVKHLPMLELMYLCLSLGFEGKYRVLPRGMLELEAVRDSLY
RQIRQMRGDIPRELSPHWEGLKDTRRRLVRIVPWWMVALFTLMCLGVIYGGFAWVLGEQRESVLQPYRSL
DMDAGDSTFSGMR
 
Nucleotide Sequence: 882 bp     [Download]
>gi|431925209|ref|NC_019936.1|:4427632-4428513 Pseudomonas stutzeri RCH2 chromosome, complete genome
ATGATCAAGGAAATGGATTACGGACAGGACGACCGCACGGTCATCGTCAATCGAGCGGGAGAGACCCCGG
CGCAGAGCCCGCTGACCGACTTCGACACCCCGCCGCGCTTCGAGCAGCTGGAGGAGCGGATGATCTACGC
CGCGCGTCTGCGCCCGGCGGAAACCTTCAACATCAGCCTCAATCCGCTGGTAGCTGCCGCCTCGCCGCTG
CTGTCGGAAGTGGTGCGCTTCAAGCACAGCCTGGAAAGCGAAGACTTGCAGGCCCTGCATGGCCAGTTGA
GCAGCGCGATCAAGCTGTTCGAACATCGCGCGCTGCATGACGGCGCCGAAAGCAGCCAGGTGATGGCGGC
GCGCTACGTGCTCTGCACCGTGCTCGACGAGGCCGTGGTAACCACGCCCTGGGGCAACGAGAGCGAATGG
TCGCAGATGAGCCTGCTGTCCTCCTTCCACAACGAGACCTTCGGCGGCGAGAAGTTCTTCCAGCTGCTCG
AGCGGCTGTCGCGCAACCCGGTCAAGCACCTGCCGATGCTCGAGCTGATGTACCTCTGCCTGTCCCTCGG
CTTCGAGGGCAAGTACCGCGTGCTGCCGCGCGGCATGCTCGAACTGGAGGCCGTGCGCGACAGCCTCTAC
CGGCAGATCCGCCAGATGCGTGGCGACATCCCGCGCGAGCTTTCGCCGCACTGGGAAGGCCTCAAGGACA
CCCGCCGGCGCCTGGTGCGCATCGTGCCCTGGTGGATGGTCGCGCTGTTCACCCTGATGTGCCTCGGGGT
GATCTACGGCGGTTTCGCCTGGGTGCTGGGCGAACAACGCGAGAGCGTGCTGCAACCCTATCGCTCGCTG
GACATGGATGCCGGCGATTCCACCTTTTCAGGGATGAGATGA