SecReT6
Protein ID: 431929314
SecReT6 ID718
T6SS typeN/A
Gene symbol-
Locus tagPsest_4249
StrainPseudomonas stutzeri RCH2
Repliconchromosome [GenBank: NC_019936] [Browse all T6SS(s) in this replicon]
Location [Strand]4433774..4435819 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDL0GPN7
KEGG IDpsh:Psest_4249
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.20E-75, Aligned region: 29..330
Phage_GPD [PF05954], Evalue: 7.20E-75, Aligned region: 524..551
Phage_base_V [PF04717], Evalue: 4.80E-25, Aligned region: 378..471
DUF2345 [PF10106], Evalue: 0.00013, Aligned region: 581..623
Protein Sequence: 681 a.a.     [Download]
>gi|431929314|ref|YP_007242348.1| Rhs element Vgr protein [Pseudomonas stutzeri RCH2]
MFNAANETHFSMTLEGVDHDFQVLEFRGREAISQPYRFDLELVSERPDLDLQALLHKPAFLTFDPAGMGI
HGLVHRIAQGESGKRLTRYRLTLVPQLAYLAHRTNQRIFQHLSVPQIIAQVLEEHGIQADAYRFQLGPVL
YPPREYCVQYDESDLHFVQRLCEEEGIHYHFEHSTRGHVLVFGDGQTSFARLGQPTAYLQDNGMTADEPV
IKRFAVRVATRTSRVGRRDYDFEQPRLLMEATHRGEPAANAMPQPDLEDYDYPGRFTERARGKHLSQRAL
ERHRHDYRLAEGNSDQPRLVSGHLLEISDHPRREWNDLWLLTEVLHEGKQPQVLEESVTSHVETGDGFIQ
GYRNHFTATPWDIPFRPALRHPKPKVLGSQTAVVTGPAGEEIHCDEYGRVRVQFHWDREGQADDKTSCWL
RVSSSWAGDRYGGIAIPRVGMEVLVTFLEGDPDQPLVTGCLYHKEHQVPYDLPANKTRTVFKTLSSPGGG
GYNELRIEDRKGQEQIYIHAQRDWDENIEHDQKSRVGNERHDTVDANSYSEFRAEEHQTVAGDRKVEVKP
DDHLTIGQTQHIKLGTAQLTKAGREIHLKAGQKMVIEAGVELTLKAGGSFIKLDPGGITVSGPLARINAG
GAPGKGSGIKIKPPVLPGMADRDKAGSLLEQVSASPLNRKKKVKRMMNFSG
 
Nucleotide Sequence: 2046 bp     [Download]
>gi|431925209|ref|NC_019936.1|:4433774-4435819 Pseudomonas stutzeri RCH2 chromosome, complete genome
ATGTTCAACGCGGCCAACGAAACCCACTTCAGCATGACCCTGGAGGGCGTCGATCACGACTTCCAGGTGC
TCGAATTCCGGGGCCGCGAGGCCATCAGCCAGCCCTACCGCTTCGACCTGGAACTGGTCAGCGAGCGCCC
CGACCTCGATCTGCAGGCACTGCTGCATAAGCCCGCCTTTCTCACCTTCGACCCCGCCGGCATGGGCATA
CACGGCCTGGTCCACCGTATCGCCCAGGGCGAATCCGGCAAGCGCCTGACCCGCTATCGGCTCACGCTCG
TGCCGCAGCTGGCCTACCTCGCCCATCGCACCAACCAGCGCATATTCCAGCACCTCAGCGTGCCGCAGAT
CATCGCCCAGGTGCTCGAAGAGCACGGTATCCAGGCCGACGCCTACCGCTTCCAGCTCGGCCCGGTGCTC
TACCCGCCACGCGAGTACTGCGTGCAGTACGACGAATCGGACCTGCACTTCGTTCAGCGCCTGTGCGAGG
AAGAAGGTATCCATTACCACTTCGAGCACAGCACCAGAGGTCATGTGCTGGTCTTCGGCGATGGCCAGAC
CAGCTTCGCCCGACTCGGCCAGCCGACCGCCTATCTGCAGGACAACGGCATGACGGCTGACGAGCCGGTG
ATCAAGCGCTTCGCCGTGCGCGTCGCGACACGCACCAGCCGGGTCGGCCGTCGTGATTACGACTTCGAAC
AACCCAGGCTGCTGATGGAGGCAACCCACCGCGGCGAGCCAGCGGCGAACGCCATGCCGCAACCCGACCT
GGAGGACTACGACTACCCGGGCCGCTTCACCGAGCGCGCCCGCGGCAAACACCTGTCGCAACGCGCGCTG
GAGCGCCACCGCCACGACTACCGCCTGGCCGAGGGCAACAGCGACCAGCCGCGGCTGGTCAGCGGCCATC
TGCTGGAAATCTCCGACCACCCGCGCCGCGAATGGAACGACCTCTGGCTGCTGACCGAAGTGCTGCATGA
AGGCAAGCAGCCGCAGGTGTTGGAGGAGTCAGTCACCAGCCATGTCGAAACTGGCGACGGCTTCATCCAG
GGCTACCGCAACCACTTCACCGCTACGCCCTGGGATATCCCTTTCCGCCCGGCCCTTCGCCATCCGAAAC
CGAAGGTCCTCGGCAGCCAGACCGCCGTGGTTACCGGGCCCGCTGGCGAAGAAATCCACTGCGACGAGTA
CGGCCGCGTGCGCGTTCAATTCCACTGGGATCGCGAAGGCCAGGCCGACGACAAGACCAGCTGCTGGCTG
CGCGTCAGCTCAAGCTGGGCCGGCGACCGCTACGGCGGCATCGCGATCCCGCGCGTTGGCATGGAAGTGC
TGGTGACCTTCCTCGAAGGCGATCCCGATCAACCGCTGGTCACCGGCTGCCTGTATCACAAGGAGCATCA
GGTCCCCTACGACCTGCCGGCCAACAAGACCCGCACGGTGTTCAAGACCTTGAGTAGCCCGGGCGGTGGC
GGCTACAACGAACTGCGCATCGAAGACCGTAAGGGCCAGGAACAGATTTATATCCACGCCCAACGCGACT
GGGACGAAAACATCGAGCACGACCAGAAGAGCCGCGTCGGTAATGAACGCCACGACACCGTGGACGCCAA
CAGCTACAGCGAATTCCGCGCCGAGGAACACCAGACCGTTGCCGGCGACCGCAAAGTGGAAGTCAAACCT
GACGACCACCTCACCATCGGCCAGACCCAGCACATCAAGCTCGGCACCGCCCAGCTGACCAAGGCCGGCC
GCGAGATCCACCTCAAGGCCGGCCAGAAGATGGTCATCGAAGCCGGCGTCGAACTCACGCTTAAAGCCGG
AGGCAGCTTCATTAAGCTCGACCCAGGCGGCATCACCGTCTCTGGCCCGCTAGCGCGAATCAACGCCGGG
GGCGCGCCGGGCAAGGGATCGGGAATCAAGATCAAGCCGCCGGTGCTGCCGGGGATGGCTGATAGGGATA
AGGCGGGGAGTTTGTTGGAGCAAGTTTCCGCCAGTCCGCTCAACCGAAAAAAGAAAGTCAAAAGAATGAT
GAATTTTTCAGGCTGA