SecReT6
Protein ID: 433657591
SecReT6 ID719
T6SS typei1
Gene symbol-
Locus tagVPBB_1309
StrainVibrio parahaemolyticus BB22OP
Repliconchromosome I [GenBank: NC_019955] [Browse all T6SS(s) in this replicon]
Location [Strand]1467305..1467823 [+]
ProductTypeVI secretion Hcp protein, biofilm development
NoteTssD
UniProt IDL0HW01
KEGG IDvpb:VPBB_1309
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.30E-35, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|433657591|ref|YP_007274970.1| TypeVI secretion Hcp protein, biofilm development [Vibrio parahaemolyticus BB22OP]
MPTPAYMSINGETQGHITKDTYSADSVGNTWQEAHVDEFLVQELDHVLTVPRDPQSGQPTGQRVHRPLVV
TKVQDRSSPLLFNALVSGEKLPECLIRFYRTSVQGKQEHYYSIKLIDALLVDIQTRMNHCQDAATADRVT
EEVLKFTYRAIEVTHENCGTAGNDDWRAPREA
 
Nucleotide Sequence: 519 bp     [Download]
>gi|433656322|ref|NC_019955.1|:1467305-1467823 Vibrio parahaemolyticus BB22OP chromosome 1, complete sequence
ATGCCAACTCCAGCATATATGTCTATCAACGGTGAAACTCAAGGTCACATTACTAAAGATACATACTCTG
CAGATTCAGTAGGTAACACATGGCAAGAAGCTCACGTTGATGAGTTCCTAGTACAAGAACTTGATCACGT
GCTAACTGTTCCACGTGATCCACAAAGTGGTCAACCTACTGGTCAACGTGTACACCGTCCACTTGTTGTG
ACTAAAGTTCAAGACCGTTCTTCTCCACTACTATTTAACGCATTAGTGTCTGGTGAAAAACTTCCTGAGT
GTTTGATTCGTTTCTACCGTACTTCAGTTCAAGGCAAGCAAGAGCACTACTACTCAATCAAGCTGATTGA
TGCGCTATTGGTAGATATCCAAACTCGTATGAACCACTGTCAAGATGCAGCAACAGCTGATCGCGTTACA
GAAGAAGTTCTTAAGTTTACTTACCGTGCAATCGAAGTAACTCACGAAAACTGTGGTACAGCTGGTAACG
ACGACTGGCGTGCTCCACGCGAAGCATAA