SecReT6
Protein ID: 433657592
SecReT6 ID719
T6SS typei1
Gene symbol-
Locus tagVPBB_1310
StrainVibrio parahaemolyticus BB22OP
Repliconchromosome I [GenBank: NC_019955] [Browse all T6SS(s) in this replicon]
Location [Strand]1467896..1469974 [+]
ProductVgrG protein
NoteTssI
UniProt IDL0HTC4
KEGG IDvpb:VPBB_1310
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.80E-69, Aligned region: 26..332
Phage_GPD [PF05954], Evalue: 2.80E-69, Aligned region: 501..536
Phage_base_V [PF04717], Evalue: 9.10E-23, Aligned region: 312..332
Phage_base_V [PF04717], Evalue: 9.10E-23, Aligned region: 371..463
Gp5_C [PF06715], Evalue: 1.00E-05, Aligned region: 505..522
Gp5_C [PF06715], Evalue: 1.00E-05, Aligned region: 534..543
Gp5_C [PF06715], Evalue: 1.00E-05, Aligned region: 547..565
Gp5_C [PF06715], Evalue: 1.00E-05, Aligned region: 568..591
Gp5_C [PF06715], Evalue: 1.00E-05, Aligned region: 593..615
Gp5_C [PF06715], Evalue: 1.00E-05, Aligned region: 616..636
Gp5_C [PF06715], Evalue: 1.00E-05, Aligned region: 673..691
DUF2345 [PF10106], Evalue: 0.0045, Aligned region: 493..505
DUF2345 [PF10106], Evalue: 0.0045, Aligned region: 631..689
Protein Sequence: 692 a.a.     [Download]
>gi|433657592|ref|YP_007274971.1| VgrG protein [Vibrio parahaemolyticus BB22OP]
MVNDVEFKFEVPGCGHEFRVESFQVNEELSKPFHISLSLLSLDPDISFDSLIRKAGTLTLYGQGLSAARI
FNGVVNEVRYLGTGRRFSRYQLVLVPQAWFLSQRQDCRIFQQKSAKDIITEVLDDGSVTDYRFELSGIYP
PKEYALQYRESDLHFVQRMMAEHGMWYYFDHTDSNHTMVIVDSNDAIAPLVSSPLNASYIGPIVYHADSG
GVADREHISDLELVNRVRTGQVTYTDYNYEQPKIPQEMTHAGDLDQDLKQFDYPGRYVDPVMGQMRTTEW
MSEHIVDNQQVEASSDVMRLASGYSFNISDHPRSEINRDYIMLSVMHTGQDPQVHEDEASGMPTTYYNQF
TCIPRDVVFKAPKLAAPVVDGPQTAVVVGPAGEEIYTDKLGRIKVQFHWDRYGNNDEHASCWIRVSQSMA
APTWGAVYLPRIGHEVVVTFLEGDPDRPLVTGAVYNGLHFPPYSLPENKTRTTFRTQTHKGTGYNELSFE
DEANQEEVYIHAQKDMSTKVLNNRYRDIGQDEFLKVARHQTNEVHGDHKETIDGHKTTQVNSTFTETVEQ
DVTVTYNANETQYVKNNSDLEIGDNRTTKIGKNDDLDVGENSNLTVGASKSSDIGADDNQTVGGNLTVSV
KGNTSYKADGATQIISGDKIVLKTGGSSLVMNSDGSIKLSGSSITIEGSDKVVVKGGNVAIN
 
Nucleotide Sequence: 2079 bp     [Download]
>gi|433656322|ref|NC_019955.1|:1467896-1469974 Vibrio parahaemolyticus BB22OP chromosome 1, complete sequence
ATGGTGAATGACGTAGAATTTAAATTTGAAGTGCCAGGGTGTGGGCACGAGTTTCGAGTAGAAAGCTTTC
AAGTAAATGAAGAGCTTTCGAAACCTTTTCACATCAGTCTCTCATTACTTTCACTTGATCCAGATATCTC
TTTTGATTCGTTAATACGAAAAGCAGGTACACTGACTCTTTATGGACAAGGCTTAAGCGCGGCACGCATA
TTCAATGGTGTGGTGAACGAAGTTCGTTATTTGGGTACAGGCCGTCGCTTCTCTCGCTATCAGTTAGTTT
TGGTTCCGCAAGCTTGGTTCTTATCACAACGTCAAGACTGTCGTATTTTCCAACAAAAATCAGCGAAAGA
TATAATTACAGAGGTGCTTGATGATGGTTCAGTGACCGACTATCGTTTTGAATTATCTGGTATTTATCCA
CCAAAAGAGTACGCGCTGCAATACCGTGAGTCAGACCTACACTTTGTTCAGCGTATGATGGCAGAACACG
GTATGTGGTACTATTTCGACCACACCGATTCAAACCACACAATGGTCATTGTCGATAGTAACGATGCCAT
TGCTCCACTGGTTAGCTCTCCTCTCAATGCATCTTATATTGGGCCGATTGTATATCACGCCGATAGTGGG
GGTGTTGCTGACCGTGAGCATATATCCGATCTCGAGTTAGTTAACCGTGTGAGAACGGGTCAGGTTACTT
ACACTGACTACAATTACGAGCAGCCAAAGATCCCGCAAGAGATGACTCACGCAGGTGATCTGGACCAAGA
TTTAAAGCAGTTTGATTATCCTGGACGTTATGTTGATCCTGTAATGGGGCAGATGAGAACCACTGAGTGG
ATGTCCGAGCACATTGTCGATAATCAGCAAGTAGAAGCGAGCAGTGATGTGATGCGTTTGGCGTCTGGTT
ACAGCTTTAACATCAGTGACCATCCTCGCTCTGAAATCAACCGTGATTACATCATGTTATCCGTCATGCA
CACAGGGCAAGACCCACAAGTGCACGAAGACGAAGCGAGTGGCATGCCAACTACTTACTACAACCAGTTC
ACGTGTATTCCACGTGATGTTGTATTCAAAGCGCCCAAGTTGGCGGCTCCAGTAGTGGATGGTCCGCAAA
CTGCGGTTGTAGTTGGTCCTGCAGGGGAGGAGATTTACACCGATAAACTAGGACGAATTAAGGTTCAGTT
CCATTGGGATCGCTATGGTAACAACGATGAACATGCAAGTTGCTGGATTCGTGTGAGTCAATCAATGGCT
GCTCCAACGTGGGGCGCGGTTTACTTGCCACGTATTGGTCATGAAGTCGTAGTCACCTTCCTTGAAGGCG
ACCCAGATCGCCCATTGGTGACTGGCGCAGTTTATAACGGTCTTCACTTCCCTCCGTACTCGTTGCCTGA
GAACAAAACTCGTACTACGTTCCGTACGCAAACGCACAAAGGCACCGGCTACAACGAACTGAGTTTTGAA
GACGAAGCGAACCAAGAAGAAGTCTACATTCATGCTCAAAAAGACATGTCGACCAAAGTTCTCAACAATC
GTTACCGAGATATCGGTCAGGATGAGTTCTTAAAGGTTGCGCGTCATCAGACGAACGAAGTCCATGGTGA
TCATAAAGAAACCATTGATGGCCACAAAACAACCCAAGTAAACAGCACTTTTACCGAGACAGTAGAGCAA
GACGTTACCGTTACATACAACGCCAACGAAACCCAATATGTGAAGAACAATTCTGATTTGGAAATTGGTG
ATAACCGCACAACCAAGATCGGCAAGAACGATGACTTGGATGTGGGTGAAAACAGTAACTTAACTGTTGG
TGCATCAAAAAGCTCGGACATTGGTGCCGATGATAACCAAACAGTGGGTGGCAACTTAACCGTATCGGTA
AAAGGCAATACATCTTACAAAGCCGATGGCGCGACACAGATCATCAGTGGAGACAAGATTGTACTGAAAA
CAGGCGGTTCTTCTTTAGTGATGAACAGTGATGGTTCAATCAAGCTCTCAGGGTCTTCAATCACCATTGA
AGGCAGCGATAAAGTCGTCGTGAAAGGTGGTAACGTAGCGATTAACTAA