SecReT6
Protein ID: 433657598
SecReT6 ID719
T6SS typei1
Gene symbol-
Locus tagVPBB_1316
StrainVibrio parahaemolyticus BB22OP
Repliconchromosome I [GenBank: NC_019955] [Browse all T6SS(s) in this replicon]
Location [Strand]1476004..1477578 [+]
ProductUncharacterized protein ImpA
NoteTssA
UniProt IDL0HXB2
KEGG IDvpb:VPBB_1316
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.80E-17, Aligned region: 48..108
Protein Sequence: 524 a.a.     [Download]
>gi|433657598|ref|YP_007274977.1| Uncharacterized protein ImpA [Vibrio parahaemolyticus BB22OP]
MSVIEIERLLAPISDVNPVGEDARYEFCYEMMESEVKKFGSLFGETVDWSVVKTHATEVLEHHSKDLKAI
CYLVRALTEEFGLLGFEQGLKLLSEALNRFGVELYPSRKRGRDGAVEWLNHQFKLVSSRFAESAQSWDLV
SGCISTIEEVQRQYDDIYQDSEADFFEIRSQLNALSQQATVDEQSDGAMATIEQTAPLTASQPVAVETPA
QSEVQTVVAKAVPSAPKPAPVKKIVTKEVDVDTDFSSPTASKRTLKKVAEVMIHANPSEPLAYRIYRHLT
WDDIDGLPDHQSNETPLSLAVSSDQQAEYRDKASQESDIDTVKRLERTLTDAPFWLTGHYFVYSMLNNLG
FNDAALAVKQEVKRFVDSLEGIELLTFKNSIPFADEATLSWLSTQAATSSSAQSVVQTIVITDEDSLPME
DITLANLGEYAAELAHKLELDFSGRGQFMLHLQLIAAYQSVGLYPLCLPYLEKAWEVQQAFNLASWEPHL
SSQLEDLIRKTLHQLFRNKDLLPEQYEKWKAIYD
 
Nucleotide Sequence: 1575 bp     [Download]
>gi|433656322|ref|NC_019955.1|:1476004-1477578 Vibrio parahaemolyticus BB22OP chromosome 1, complete sequence
ATGTCTGTGATCGAAATTGAACGTTTACTTGCGCCTATCTCTGACGTAAATCCTGTCGGTGAAGATGCTC
GTTACGAGTTTTGTTATGAAATGATGGAATCCGAAGTGAAGAAGTTCGGATCCTTGTTTGGCGAAACGGT
AGATTGGAGTGTCGTAAAAACGCACGCCACTGAAGTTCTTGAACACCACAGCAAAGATTTAAAAGCAATT
TGTTACCTTGTTCGCGCGCTTACAGAAGAGTTTGGTCTGCTAGGTTTCGAGCAAGGTCTAAAGCTGCTTA
GTGAAGCGTTAAATCGTTTTGGCGTTGAGCTGTACCCGTCGCGAAAACGGGGTAGAGATGGTGCGGTAGA
GTGGTTGAACCATCAGTTTAAATTGGTGAGCAGCAGGTTTGCAGAAAGCGCTCAGTCATGGGATTTGGTT
TCAGGTTGTATTTCGACTATCGAAGAAGTCCAACGTCAGTACGACGATATTTACCAAGACTCCGAAGCGG
ACTTCTTTGAAATTCGTAGTCAACTCAATGCGCTATCTCAACAAGCGACTGTCGATGAGCAAAGCGATGG
TGCAATGGCTACCATCGAACAAACAGCTCCGCTAACGGCTTCACAGCCTGTAGCAGTAGAAACTCCGGCA
CAAAGTGAAGTTCAAACCGTTGTAGCAAAAGCGGTTCCGTCGGCTCCTAAACCTGCACCAGTTAAGAAAA
TAGTAACAAAAGAAGTCGATGTCGATACGGATTTTTCATCGCCGACCGCTTCTAAACGTACACTCAAGAA
AGTTGCGGAAGTTATGATTCATGCGAATCCAAGTGAGCCGCTAGCTTACCGAATTTATCGTCACCTAACT
TGGGATGATATTGATGGTCTTCCTGATCATCAAAGCAATGAAACGCCATTGAGTTTGGCTGTGTCGTCTG
ATCAGCAGGCTGAGTACCGCGATAAAGCCTCTCAAGAAAGCGACATTGATACAGTTAAGCGTTTGGAGCG
CACGTTAACCGATGCTCCGTTTTGGCTGACGGGTCACTACTTTGTTTATTCGATGTTAAACAATCTAGGC
TTTAATGACGCAGCGCTCGCTGTGAAGCAAGAAGTGAAGCGTTTTGTTGATTCATTAGAGGGCATTGAAC
TCCTCACATTTAAGAATTCTATACCATTTGCAGATGAAGCAACGTTGAGCTGGTTATCGACTCAAGCTGC
AACTTCTTCAAGTGCTCAATCTGTCGTTCAAACGATTGTCATCACAGATGAAGACTCACTGCCAATGGAA
GATATCACCCTAGCCAACTTAGGGGAGTATGCCGCAGAACTCGCACACAAACTCGAACTGGATTTCTCGG
GACGTGGGCAGTTTATGCTGCATTTACAATTGATAGCAGCTTACCAGTCTGTTGGATTATACCCGTTGTG
TTTGCCTTACCTTGAAAAAGCTTGGGAAGTGCAACAAGCGTTTAATCTCGCGAGCTGGGAACCCCACTTA
TCGTCACAGCTAGAAGACCTGATTCGAAAAACACTGCATCAGTTATTCAGAAACAAGGATCTTTTGCCTG
AACAGTACGAAAAGTGGAAAGCAATTTATGACTAA