SecReT6
Protein ID: 433657599
SecReT6 ID719
T6SS typei1
Gene symbol-
Locus tagVPBB_1317
StrainVibrio parahaemolyticus BB22OP
Repliconchromosome I [GenBank: NC_019955] [Browse all T6SS(s) in this replicon]
Location [Strand]1477605..1478111 [+]
ProductUncharacterized protein ImpB
NoteTssB
UniProt IDL0HY16
KEGG IDvpb:VPBB_1317
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.80E-59, Aligned region: 5..158
Protein Sequence: 168 a.a.     [Download]
>gi|433657599|ref|YP_007274978.1| Uncharacterized protein ImpB [Vibrio parahaemolyticus BB22OP]
MSRDGSVAPKERINIRYVPATGDTQEDVELPLSMMVVGDFTARADETPIEERTPINIDKDNFNDVLEGMS
PNVKVNVENRLSDEEGAQIGVDLTFQNMKDFSPEAIAKSVPELNSLLELREALVALKGPLGNVPAFRKKI
ASVLQDEEARKKLLDELSIGNDQDAKEE
 
Nucleotide Sequence: 507 bp     [Download]
>gi|433656322|ref|NC_019955.1|:1477605-1478111 Vibrio parahaemolyticus BB22OP chromosome 1, complete sequence
ATGTCACGTGACGGCTCGGTGGCTCCTAAAGAGCGAATTAATATCCGTTATGTTCCAGCAACTGGTGATA
CGCAAGAAGACGTTGAGCTGCCGCTGAGCATGATGGTGGTTGGTGACTTTACTGCACGTGCAGATGAGAC
GCCAATCGAAGAACGTACCCCAATCAACATCGATAAAGACAACTTTAATGACGTGTTAGAAGGCATGTCT
CCAAACGTTAAAGTAAATGTTGAAAACCGCTTATCTGATGAAGAAGGCGCACAGATCGGTGTTGACCTAA
CGTTCCAAAATATGAAGGACTTTTCTCCGGAAGCGATTGCGAAAAGTGTACCTGAACTTAACAGTCTTCT
TGAGCTTCGCGAAGCATTGGTTGCACTAAAAGGTCCTCTAGGTAACGTACCTGCGTTCCGTAAGAAGATT
GCATCGGTTCTTCAAGACGAAGAAGCAAGAAAGAAACTGTTGGATGAACTAAGCATTGGTAACGACCAAG
ACGCGAAAGAAGAGTAA