SecReT6
Protein ID: 433657600
SecReT6 ID719
T6SS typei1
Gene symbol-
Locus tagVPBB_1318
StrainVibrio parahaemolyticus BB22OP
Repliconchromosome I [GenBank: NC_019955] [Browse all T6SS(s) in this replicon]
Location [Strand]1478120..1479595 [+]
ProductUncharacterized protein ImpC
NoteTssC
UniProt IDL0HVB4
KEGG IDvpb:VPBB_1318
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 5.60E-187, Aligned region: 66..490
Protein Sequence: 491 a.a.     [Download]
>gi|433657600|ref|YP_007274979.1| Uncharacterized protein ImpC [Vibrio parahaemolyticus BB22OP]
MSAEAQAPEQEAALVESGSLLDSILNETRLKPSDEGFDVAKRGVEAFISELLSSSNTEKVDQSLVDLMIS
EIDQKLSKQVDAILHNEEVQAIESTWRGLKYLVDHTDFRENIQIELISAKKDEVLDDFEDAPEVVKSGLY
KQIYTREYGQFGGKPVGAVICDYNMSASSPDIKLMEYMANVGAMSHAPFITSASAKFFGLDSYEELPNLK
DLKSVFEGPQYTKWRGLREHEDARYLGLCTSRFMLRTPYSVEDNPIKAFDYDEHVTDSHDNYLWGNSAYA
MASKISESFAKYRWCPNIIGPQSGGSVHDLPVYNFEAMGQIETKIPTEILVSDRREYELAEEGFIALTMR
KGSDNAAFFSANSVQKPKVFANTPEGKQAEMNYKLGTQLPYMFIINRLAHYIKVLQREQIGSWKERSDLE
IELNKWIRQYVSDQENPPAEVRGRRPLRAAKVEVSDVEGDPGWYKVSMSVRPHFKYMGASFDLSLVGKLD
Q
 
Nucleotide Sequence: 1476 bp     [Download]
>gi|433656322|ref|NC_019955.1|:1478120-1479595 Vibrio parahaemolyticus BB22OP chromosome 1, complete sequence
ATGTCTGCAGAAGCACAAGCTCCAGAACAAGAAGCAGCCTTAGTTGAATCAGGCTCACTTCTGGATAGCA
TTCTTAACGAAACTCGTTTAAAGCCAAGTGATGAAGGTTTTGATGTTGCTAAACGTGGCGTAGAAGCATT
CATTAGTGAGCTACTGAGCAGCTCGAATACAGAGAAAGTAGACCAATCTTTGGTTGACTTAATGATCTCT
GAAATCGACCAAAAACTGTCTAAGCAAGTTGATGCGATTCTTCACAACGAAGAAGTTCAAGCGATTGAGT
CAACTTGGCGTGGCCTGAAGTATCTTGTTGATCACACTGATTTCCGTGAGAACATTCAAATCGAACTAAT
TTCAGCGAAGAAAGACGAAGTTCTTGATGATTTTGAAGATGCACCGGAAGTGGTTAAGTCTGGCCTTTAC
AAGCAGATCTACACTCGCGAATACGGCCAATTCGGTGGTAAACCTGTAGGTGCGGTAATCTGTGACTACA
ACATGTCAGCGTCTTCTCCAGACATTAAGCTGATGGAATACATGGCAAATGTGGGCGCGATGTCTCATGC
ACCTTTCATAACGTCAGCATCGGCTAAGTTCTTTGGTCTGGATAGCTACGAAGAGCTACCAAACCTAAAA
GATTTGAAGTCTGTTTTCGAAGGTCCACAATACACGAAATGGCGTGGCTTACGTGAACACGAAGATGCTC
GTTACCTAGGTCTATGTACGTCTCGCTTTATGTTACGTACACCTTACTCTGTCGAAGATAACCCAATTAA
GGCGTTTGACTACGACGAGCACGTAACAGATAGCCATGATAACTACCTATGGGGTAACTCTGCGTACGCG
ATGGCTTCTAAGATCAGTGAGTCATTTGCTAAGTACCGTTGGTGTCCAAATATCATTGGTCCTCAAAGTG
GCGGTTCGGTTCATGACTTGCCAGTTTATAACTTTGAAGCAATGGGCCAAATTGAAACGAAGATCCCAAC
AGAAATCTTGGTATCTGACCGTCGTGAATACGAGCTAGCCGAAGAGGGCTTTATCGCTCTAACGATGCGC
AAAGGTTCTGACAACGCGGCGTTCTTCTCTGCAAACTCTGTTCAAAAACCAAAAGTGTTTGCAAACACGC
CAGAAGGCAAACAAGCAGAGATGAACTATAAGCTGGGTACTCAGCTTCCTTACATGTTCATTATCAACCG
TCTAGCGCATTACATCAAAGTGCTACAACGTGAGCAAATCGGTTCATGGAAAGAGCGTTCTGACCTAGAA
ATCGAATTGAACAAGTGGATCCGTCAATACGTTTCTGACCAAGAGAACCCACCAGCAGAAGTCCGTGGTC
GTCGTCCACTGCGTGCTGCTAAGGTTGAGGTATCAGACGTAGAAGGCGATCCAGGCTGGTACAAAGTATC
AATGTCTGTACGTCCTCACTTCAAGTACATGGGCGCAAGTTTCGACTTGTCTCTAGTTGGTAAACTAGAC
CAATAA