SecReT6
Protein ID: 433657601
SecReT6 ID719
T6SS typei1
Gene symbol-
Locus tagVPBB_1319
StrainVibrio parahaemolyticus BB22OP
Repliconchromosome I [GenBank: NC_019955] [Browse all T6SS(s) in this replicon]
Location [Strand]1479657..1480067 [+]
Producthypothetical protein
NoteTssE
UniProt IDL0HW09
KEGG IDvpb:VPBB_1319
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.00E-20, Aligned region: 24..116
Protein Sequence: 136 a.a.     [Download]
>gi|433657601|ref|YP_007274980.1| hypothetical protein VPBB_1319 [Vibrio parahaemolyticus BB22OP]
MEKGYRLLERIELGEPKNCYEKVVSHKHLIESIHLHLADLLNTHSGNAMIDSEYGLPDFNDVLSNNTNLV
RHIQKNITATIERFEPRLLNVEVHYREDHHNPLQLGFGIRGEVSHNGGKVPMSIDVYMGTDGQFNV
 
Nucleotide Sequence: 411 bp     [Download]
>gi|433656322|ref|NC_019955.1|:1479657-1480067 Vibrio parahaemolyticus BB22OP chromosome 1, complete sequence
ATGGAAAAAGGTTATCGTCTTTTAGAGCGGATTGAACTAGGTGAGCCAAAAAACTGCTACGAGAAAGTGG
TCTCCCACAAGCATTTGATTGAATCTATTCATTTGCATCTTGCAGATTTGCTGAATACGCATTCTGGTAA
TGCGATGATCGATAGTGAATATGGTTTGCCCGATTTTAATGACGTTCTGTCTAATAATACGAATCTCGTT
CGCCACATCCAAAAGAACATCACAGCGACCATAGAACGCTTTGAACCTCGGCTACTTAACGTCGAAGTTC
ACTATCGTGAAGACCACCACAATCCATTACAGCTCGGTTTTGGTATTCGCGGAGAAGTTTCCCATAACGG
CGGTAAAGTTCCAATGTCGATCGATGTCTACATGGGAACCGACGGCCAATTCAACGTTTAG