SecReT6
Protein ID: 433657602
SecReT6 ID719
T6SS typei1
Gene symbol-
Locus tagVPBB_1320
StrainVibrio parahaemolyticus BB22OP
Repliconchromosome I [GenBank: NC_019955] [Browse all T6SS(s) in this replicon]
Location [Strand]1480078..1481826 [+]
ProductProtein ImpG
NoteTssF
UniProt IDL0HTD4
KEGG IDvpb:VPBB_1320
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.40E-191, Aligned region: 5..582
Protein Sequence: 582 a.a.     [Download]
>gi|433657602|ref|YP_007274981.1| Protein ImpG [Vibrio parahaemolyticus BB22OP]
MSNSKYFQDELTYLRESGSEFAKYHPKLTHFLSEGTFDPDVERLLEGFAFLTGRIREKIDDELPELTQSL
MTLLWPHYMRSIPSLCISELKPHTGSVTEKTVVKRGAEMASEQVEGTQCLFRTCYDVNLYPITITNIEQT
NSRTSSAIDVTLSTEHGLELSRIGLDTLRLHLHGEIHITRTVFLWLFRYLDYVELDVGGGYKHRLGPEYV
KPVGHEEDEALLPYSKNSFAGYRLLQELFSLPDKFMFFDITGLEWLKGIPQRSTVKIKFHFKRALPSEVV
LKDKHLRLHCTPAVNLFEKDGDPIRLEHRRNEYKVRPQSNTQEHYEVYSIEQVESWSKDERRRKPLIEFE
SFEHQINQRDKREFYKSKVGERVSGRGLERYISFHTHNGDIADLGTETVLMKLQCSNADLAERLSVGDIT
YATHKSPTYATFKNITKPTQSVSPQVNGELQWQLIANMSLNYLSLANIDVLKVLLSTYDFHSRVDRQAHR
ASIHRLDGIISSEMKPIDRVFRGVSVRGNQFKLVTNSKFFVNEGDMFLMATVLNEFIRLYSSVNSFTELE
VFDEATGEVYNWKSLIGQQTIL
 
Nucleotide Sequence: 1749 bp     [Download]
>gi|433656322|ref|NC_019955.1|:1480078-1481826 Vibrio parahaemolyticus BB22OP chromosome 1, complete sequence
TTGAGTAATAGTAAATACTTTCAAGATGAACTCACATATTTGCGCGAATCGGGTAGTGAATTTGCCAAAT
ATCATCCGAAGTTAACTCACTTTCTCTCTGAAGGAACATTCGACCCAGATGTCGAGCGATTGCTGGAAGG
TTTCGCTTTTCTGACTGGACGTATTCGAGAGAAGATCGATGACGAACTGCCAGAACTGACGCAATCTCTG
ATGACTTTGCTGTGGCCGCATTACATGCGTTCAATTCCATCTTTGTGCATCAGCGAGCTAAAACCACATA
CGGGAAGTGTTACTGAGAAAACGGTGGTAAAACGTGGCGCAGAAATGGCCAGTGAGCAAGTGGAGGGCAC
GCAATGTCTTTTCCGCACTTGCTACGATGTGAATCTGTACCCAATCACGATCACCAACATTGAACAAACC
AACAGCCGCACCAGTTCAGCGATTGATGTGACGTTGTCGACGGAGCATGGCCTAGAGCTGTCTCGAATTG
GTTTAGATACGTTGCGTTTGCACTTGCATGGTGAGATTCATATTACCCGCACTGTCTTCCTCTGGCTGTT
CCGTTACTTGGATTACGTGGAGTTGGATGTCGGTGGCGGCTATAAACATCGTTTAGGGCCAGAATATGTT
AAGCCGGTAGGGCATGAAGAAGACGAAGCGCTTCTGCCTTACAGCAAAAATTCATTCGCGGGTTATCGTT
TGCTGCAAGAATTATTCTCTTTGCCAGACAAGTTTATGTTCTTCGACATTACAGGTTTGGAGTGGCTAAA
GGGTATTCCACAACGAAGCACAGTGAAAATCAAATTTCACTTTAAACGCGCATTGCCGTCAGAGGTTGTA
CTTAAAGATAAGCACTTAAGGTTGCACTGCACGCCGGCGGTGAATTTGTTTGAAAAAGATGGCGACCCAA
TTCGTTTGGAGCACCGTCGTAACGAATACAAAGTCCGTCCTCAAAGTAATACGCAAGAGCACTATGAAGT
GTATTCCATTGAGCAAGTTGAGAGTTGGAGCAAAGACGAGCGTCGCCGTAAACCGTTAATCGAATTCGAA
TCGTTCGAGCATCAAATCAACCAACGAGACAAGCGAGAATTCTATAAGTCGAAGGTAGGAGAGCGTGTTA
GTGGAAGAGGCTTAGAGCGCTATATCTCGTTCCACACTCATAATGGTGATATTGCGGATTTAGGTACGGA
AACCGTACTCATGAAACTGCAATGCAGTAACGCTGATTTGGCCGAACGTCTTTCGGTCGGCGACATTACT
TACGCGACCCACAAATCGCCAACGTATGCGACATTTAAAAACATCACCAAGCCAACACAATCGGTAAGCC
CACAGGTAAACGGCGAGCTTCAATGGCAGTTGATTGCCAATATGTCGCTCAATTATTTGTCTTTGGCAAA
CATTGATGTATTAAAAGTTCTGCTCTCGACCTATGACTTTCATTCTCGTGTTGACAGACAAGCTCACCGA
GCATCGATTCACCGACTCGATGGCATTATATCGTCAGAGATGAAACCAATTGACCGTGTATTCCGTGGCG
TGTCTGTGCGTGGTAACCAGTTCAAACTAGTAACCAACTCTAAGTTCTTCGTCAATGAAGGCGATATGTT
CCTGATGGCAACGGTACTGAACGAATTCATCCGTTTGTATTCGAGTGTAAACTCCTTTACCGAGCTAGAA
GTATTTGATGAGGCAACCGGTGAAGTATACAACTGGAAAAGCTTAATCGGGCAGCAGACGATTCTATGA