SecReT6
Protein ID: 433657603
SecReT6 ID719
T6SS typei1
Gene symbol-
Locus tagVPBB_1321
StrainVibrio parahaemolyticus BB22OP
Repliconchromosome I [GenBank: NC_019955] [Browse all T6SS(s) in this replicon]
Location [Strand]1481823..1482821 [+]
ProductUncharacterized protein ImpH
NoteTssG
UniProt IDL0HXB7
KEGG IDvpb:VPBB_1321
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.80E-83, Aligned region: 8..317
Protein Sequence: 332 a.a.     [Download]
>gi|433657603|ref|YP_007274982.1| Uncharacterized protein ImpH [Vibrio parahaemolyticus BB22OP]
MINTLSEKSNEFSFYQAVLLLEKHYQFEPNSNFVAVGENKYFHQERIEFSVSPNLCFPKSDMEFIVHMER
SGQQYSRVETNFLGLHGSSSPLPASYTEKLTGREPDDNPVKDFFDFFHNRYTSLLYRVWKKYRYHVQYQS
GATDAFSGRMLHLAGLSGVMQDCGVAELDRAKVLSYVNQLSTRTRSPKLISGIVSHYFSLPSVRIEEWVY
RRVEIADSQRNKLNRANCILGQSFHLGQSIADLNGKFNLCIDDIDFETFKQFSYEGELHKTLVGLMRFIL
RDPMSWDLKLTVNLDSIPNNQLGNGEGNNLGQTFWLGNPTDEDVKIRVIGSI
 
Nucleotide Sequence: 999 bp     [Download]
>gi|433656322|ref|NC_019955.1|:1481823-1482821 Vibrio parahaemolyticus BB22OP chromosome 1, complete sequence
ATGATTAATACACTTTCTGAAAAATCGAATGAGTTTAGTTTTTATCAAGCGGTTCTTTTGCTCGAGAAGC
ACTACCAGTTTGAACCAAACTCTAACTTTGTCGCCGTGGGAGAGAACAAATATTTTCACCAGGAGCGAAT
TGAGTTCAGCGTGTCGCCTAATCTATGCTTCCCTAAGAGTGATATGGAATTTATCGTTCATATGGAACGA
AGTGGGCAGCAGTATTCACGAGTCGAAACGAACTTCCTTGGTTTGCATGGTTCGAGCTCTCCATTGCCTG
CCTCTTATACGGAGAAACTTACTGGGCGTGAACCTGATGACAACCCGGTAAAAGATTTCTTTGATTTCTT
CCATAATCGCTACACCAGTTTGCTCTATCGTGTCTGGAAGAAGTACCGTTATCATGTACAGTACCAAAGT
GGTGCGACAGACGCTTTTTCTGGACGGATGCTGCACTTAGCTGGTTTATCAGGTGTTATGCAAGATTGTG
GTGTTGCAGAATTAGACCGCGCAAAAGTCCTGTCTTACGTTAATCAACTGTCGACACGTACGCGTTCCCC
TAAGCTAATTTCAGGTATCGTTTCACATTATTTCTCACTTCCTAGCGTTCGCATCGAAGAATGGGTTTAT
CGCCGTGTGGAGATTGCAGACAGTCAACGAAATAAACTCAATCGAGCCAATTGCATATTAGGTCAAAGCT
TTCATTTAGGGCAGAGTATCGCAGATTTAAATGGTAAGTTTAATCTTTGCATTGATGACATTGACTTCGA
GACATTTAAGCAGTTTTCTTACGAAGGTGAGTTGCATAAAACGTTGGTTGGTTTAATGAGATTCATCTTG
CGTGACCCGATGTCTTGGGATCTCAAACTGACAGTTAATCTCGACAGTATTCCAAATAACCAACTTGGCA
ATGGAGAAGGGAACAACTTAGGGCAGACATTTTGGTTAGGCAATCCTACAGATGAAGATGTGAAGATCAG
AGTAATTGGTAGCATTTAG