SecReT6
Protein ID: 433657608
SecReT6 ID719
T6SS typei1
Gene symbol-
Locus tagVPBB_1326
StrainVibrio parahaemolyticus BB22OP
Repliconchromosome I [GenBank: NC_019955] [Browse all T6SS(s) in this replicon]
Location [Strand]1489205..1490725 [+]
ProductUncharacterized protein ImpI
NoteFha
UniProt IDL0HXC3
KEGG IDvpb:VPBB_1326
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.20E-16, Aligned region: 31..97
Aconitase [PF00330], Evalue: 0.0073, Aligned region: 244..312
Protein Sequence: 506 a.a.     [Download]
>gi|433657608|ref|YP_007274987.1| Uncharacterized protein ImpI [Vibrio parahaemolyticus BB22OP]
MQTHQLVLFISKCPEEYTGAKHIEMPEGGGSVGRAPSCTLSLTDHNRFISGTHCLISVYGDTFYISDVST
NGTMVNGNKILKNQPISIVDGDVVSLGQYEIGVALEHISAVQDIAADIAPERVSNDPLVNLGEAVVEEEE
KVGALEDLFMETKQDGVNTDDPIAHLKFSMQREDDYLIRDVEKPEPAPAKTIENTRQVVDDSFSIHSEFD
IPNLIPEDWLGGVATSKESVEPAAEQAKQAAFIPEDFAHTKPVSPQASVVQPDVNQPQQPQYEAPLSHAT
SNVTQRAEPVSQKWEEVTQAFVPSAQPTQLETKAKAKEAQQGFVSNESLAIESAAHSSDIGKAFYEGLGI
SNPDLISNEALLFKQMGACLRLCIDNLQKDLHEVESLKGEQGLSEADSNLAELMLTLNSQNLLSPNELVE
QMLDELNDHQIIFNKALNELLIEQSETNDPVTFANDVASKSMFTTKSKLWGEYLEFYANNRRQMNETSLK
GLIKKNYTKAIKGSHA
 
Nucleotide Sequence: 1521 bp     [Download]
>gi|433656322|ref|NC_019955.1|:1489205-1490725 Vibrio parahaemolyticus BB22OP chromosome 1, complete sequence
ATGCAAACACATCAGCTAGTCCTATTTATTTCTAAATGCCCAGAGGAATATACGGGCGCAAAGCATATTG
AAATGCCAGAAGGTGGTGGCTCAGTTGGACGAGCGCCTAGCTGCACTCTGTCTTTAACGGACCATAACCG
TTTTATCTCTGGTACACACTGTTTGATAAGTGTATACGGTGACACTTTCTACATTAGCGATGTGTCGACA
AATGGCACTATGGTTAATGGTAATAAGATTCTAAAGAATCAACCGATATCTATTGTTGACGGTGACGTTG
TTTCATTAGGGCAGTACGAGATTGGCGTTGCATTAGAGCATATATCCGCTGTTCAAGATATTGCCGCCGA
TATTGCCCCAGAAAGAGTATCGAATGATCCACTCGTCAATCTCGGTGAGGCGGTCGTAGAAGAGGAAGAA
AAAGTCGGTGCATTAGAAGACTTATTCATGGAGACCAAGCAAGACGGTGTTAATACTGACGATCCTATTG
CGCATCTAAAGTTTTCGATGCAGCGTGAAGACGACTATCTTATCCGCGATGTTGAAAAGCCTGAGCCTGC
ACCGGCTAAGACAATCGAAAATACGCGACAAGTCGTTGATGACAGTTTCAGTATCCATTCTGAATTCGAT
ATTCCAAATTTAATCCCTGAAGATTGGCTGGGAGGCGTTGCCACGAGTAAAGAATCTGTTGAACCAGCGG
CAGAGCAAGCTAAGCAAGCCGCGTTCATTCCAGAAGATTTTGCGCACACGAAGCCCGTTTCGCCTCAGGC
TAGTGTGGTTCAACCAGACGTTAACCAACCTCAACAGCCTCAATATGAAGCGCCACTTAGTCACGCGACG
TCAAATGTTACTCAAAGAGCAGAGCCTGTTAGCCAGAAATGGGAAGAGGTAACACAAGCCTTTGTTCCAT
CAGCACAACCTACTCAGCTAGAAACGAAAGCGAAAGCGAAAGAGGCCCAACAAGGTTTTGTAAGCAACGA
GTCTCTAGCGATTGAGAGTGCGGCTCATTCTTCAGATATCGGTAAAGCGTTTTATGAAGGCTTGGGTATT
AGTAACCCTGATCTGATCAGTAACGAAGCTCTGCTGTTTAAACAAATGGGGGCATGTCTTCGTTTGTGTA
TCGATAACTTGCAAAAAGACTTGCATGAAGTTGAGTCACTTAAAGGTGAACAGGGTTTAAGCGAAGCGGA
TTCAAACTTAGCGGAACTGATGTTAACGCTAAATAGTCAGAACTTGCTGTCTCCGAATGAATTGGTGGAG
CAAATGTTGGATGAGCTCAACGATCATCAAATTATTTTTAACAAGGCACTCAATGAGTTGCTAATTGAAC
AATCAGAGACGAATGACCCTGTCACGTTTGCAAACGACGTTGCAAGTAAATCCATGTTCACCACCAAATC
AAAGTTATGGGGTGAGTATCTTGAGTTCTACGCCAATAACCGTCGTCAAATGAATGAGACGTCATTGAAA
GGTTTGATCAAGAAAAACTACACCAAAGCGATTAAGGGAAGCCATGCGTAG