SecReT6
Protein ID: 433657609
SecReT6 ID719
T6SS typei1
Gene symbol-
Locus tagVPBB_1327
StrainVibrio parahaemolyticus BB22OP
Repliconchromosome I [GenBank: NC_019955] [Browse all T6SS(s) in this replicon]
Location [Strand]1490769..1491218 [+]
ProductType VI secretion lipoprotein
NoteTssJ
UniProt IDL0HY27
KEGG IDvpb:VPBB_1327
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.50E-31, Aligned region: 12..135
Protein Sequence: 149 a.a.     [Download]
>gi|433657609|ref|YP_007274988.1| Type VI secretion lipoprotein [Vibrio parahaemolyticus BB22OP]
MWDQFKESTGITPETSSIELVIEASSVLNVREGGQSSPVILRVHELTSPVLFRSLDFFALFENDKASLGD
EYIKRYEYQMQPGEKIHEFLELDPATRAVGFSVAFRDIDGSSWRKVEVIEEKSEYYIKLKLEGSELISDN
TRGIEQVYF
 
Nucleotide Sequence: 450 bp     [Download]
>gi|433656322|ref|NC_019955.1|:1490769-1491218 Vibrio parahaemolyticus BB22OP chromosome 1, complete sequence
ATGTGGGATCAATTTAAAGAATCAACAGGCATCACGCCTGAAACGTCCTCGATTGAGTTGGTGATTGAGG
CATCTTCGGTTCTAAATGTTCGTGAAGGCGGACAATCCTCCCCGGTTATTTTGCGAGTTCACGAACTGAC
GTCACCAGTGTTGTTTCGTAGCTTAGACTTCTTCGCATTGTTTGAGAACGATAAAGCATCACTGGGTGAT
GAATACATCAAACGTTATGAATACCAAATGCAGCCCGGTGAAAAGATCCACGAATTTTTGGAACTCGACC
CAGCAACCCGTGCGGTTGGATTCTCAGTCGCGTTTCGCGATATTGACGGTTCTTCTTGGCGTAAAGTCGA
AGTGATTGAAGAGAAGAGCGAGTACTACATAAAACTCAAGTTAGAAGGCAGTGAGTTAATTTCTGACAAC
ACTCGCGGCATTGAACAAGTTTATTTTTAA