SecReT6
Protein ID: 433657610
SecReT6 ID719
T6SS typei1
Gene symbol-
Locus tagVPBB_1328
StrainVibrio parahaemolyticus BB22OP
Repliconchromosome I [GenBank: NC_019955] [Browse all T6SS(s) in this replicon]
Location [Strand]1491230..1492555 [+]
ProductUncharacterized protein ImpJ
NoteTssK
UniProt IDL0HVC5
KEGG IDvpb:VPBB_1328
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.80E-140, Aligned region: 19..440
Protein Sequence: 441 a.a.     [Download]
>gi|433657610|ref|YP_007274989.1| Uncharacterized protein ImpJ [Vibrio parahaemolyticus BB22OP]
MSLYNPVVWQDGMFMKPQHFQQLDRSQSKLSSMLSANASPLHWGIKRLEINSQLLALGKIGITRAEGILQ
DRTPFELPLLAELPEVKDVDPSIADKVVYLCCPLPSERSELFGTKKDGARYTLESQEAVDACYDSEDMAN
IVVGKLNFCLMYDHEDKSAYTSIPILKISEVKPDGSVILDESFIPTCIDIHASTVLNKFATEFASMLKHR
AESIVQRLGVVDQQGVSSVSDFMLLQALNRYEPLFWHFASAEGVHPESFYRILLQAEGELSTLCSASRRP
IEFTKYNHGDLTSCLSRTLDSAKMTLSVMSEQRAIPLTLKDQNYGIRTAAIPDSKIIDTTTFILAVKADV
TLDVLHTQFVSQTKIGSIDNIRDLINLQLPGIEIKPMPVVPRALPYHAGYTYFELDKTGEEWAAMKNTAA
IAVHVAGDFANLSLQLWAVRL
 
Nucleotide Sequence: 1326 bp     [Download]
>gi|433656322|ref|NC_019955.1|:1491230-1492555 Vibrio parahaemolyticus BB22OP chromosome 1, complete sequence
ATGTCTTTATACAATCCAGTTGTTTGGCAAGATGGAATGTTCATGAAGCCGCAGCACTTTCAGCAACTCG
ATCGTTCACAAAGTAAACTGTCGAGCATGCTGAGCGCAAATGCATCACCTTTGCATTGGGGCATTAAGCG
CTTAGAGATTAACTCGCAACTATTGGCGTTGGGCAAAATTGGTATCACTCGTGCTGAAGGTATTCTTCAA
GACAGAACACCATTTGAGCTGCCGCTGCTGGCTGAACTTCCAGAAGTGAAAGACGTTGATCCTTCGATCG
CTGACAAAGTGGTTTACCTTTGTTGTCCGTTACCTTCTGAGCGCTCTGAACTATTCGGCACCAAGAAAGA
CGGCGCACGTTACACGCTGGAATCTCAAGAGGCGGTTGACGCTTGTTATGATTCAGAAGACATGGCAAAT
ATCGTAGTCGGTAAGCTTAACTTCTGCTTGATGTATGACCATGAAGATAAGAGTGCTTACACATCAATTC
CAATTCTGAAGATCTCAGAAGTGAAGCCAGACGGCAGTGTTATCTTGGATGAAAGCTTTATCCCGACTTG
TATCGATATTCATGCCTCTACCGTGCTAAACAAGTTCGCAACCGAGTTTGCCTCTATGCTGAAACACCGC
GCAGAATCCATCGTTCAGCGCCTCGGCGTGGTTGACCAGCAAGGAGTATCTTCAGTTTCTGATTTCATGT
TGCTGCAAGCTCTAAACCGATACGAGCCGCTATTCTGGCACTTTGCGAGCGCAGAAGGGGTTCATCCTGA
ATCGTTTTATCGCATTCTTCTTCAAGCGGAAGGTGAGCTTTCGACTTTGTGTTCAGCATCTCGTCGACCA
ATCGAGTTCACCAAGTACAACCATGGCGACCTAACCAGCTGTCTATCGCGTACATTGGATAGTGCGAAGA
TGACACTAAGTGTGATGTCTGAGCAGCGTGCAATCCCACTGACGTTGAAAGACCAAAACTACGGTATTAG
AACGGCAGCGATTCCAGACAGTAAGATTATCGACACCACGACCTTTATTCTTGCGGTTAAAGCCGACGTT
ACTTTGGATGTTCTTCACACCCAGTTTGTTAGTCAAACGAAGATCGGTTCTATCGATAACATTCGTGACT
TGATTAACCTGCAACTGCCGGGCATCGAGATTAAACCAATGCCAGTCGTACCTCGCGCATTGCCTTACCA
CGCAGGTTACACCTACTTCGAACTGGATAAGACAGGCGAAGAGTGGGCAGCAATGAAAAACACGGCTGCA
ATTGCGGTTCACGTAGCCGGCGACTTTGCTAACTTGTCGCTGCAACTATGGGCAGTTCGTCTATGA