SecReT6
Protein ID: 433657611
SecReT6 ID719
T6SS typei1
Gene symbol-
Locus tagVPBB_1329
StrainVibrio parahaemolyticus BB22OP
Repliconchromosome I [GenBank: NC_019955] [Browse all T6SS(s) in this replicon]
Location [Strand]1492552..1493343 [+]
ProductOuter membrane protein ImpK
NoteTssL
UniProt IDL0HW20
KEGG IDvpb:VPBB_1329
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 7.00E-55, Aligned region: 46..248
Protein Sequence: 263 a.a.     [Download]
>gi|433657611|ref|YP_007274990.1| Outer membrane protein ImpK [Vibrio parahaemolyticus BB22OP]
MSYAETDVTVVLFQPEPGKPMEVMPAPDLSRNIAVQDLNIENMGINPLVDQFSWLIASLSCMSSIPWLDD
PMPFREQVAREIRKGERKLNEMELDRASILVIRYCLCAAIDESVCRQEWGANSHWSQNSLLSEFHNETSG
GDKFFVILERLKADPRKYRHVIEFLYLLLQLGFQGKYGREERGNEKLAEIGNTIYRLVRDERLAEQEKVS
LVNLKAKYLKKPLKRVISPKLILGVSAITFAIMYAATYIVIDLKFQQLLEVYR
 
Nucleotide Sequence: 792 bp     [Download]
>gi|433656322|ref|NC_019955.1|:1492552-1493343 Vibrio parahaemolyticus BB22OP chromosome 1, complete sequence
ATGAGTTACGCAGAAACTGACGTTACTGTAGTCTTATTCCAACCAGAGCCAGGCAAACCGATGGAGGTGA
TGCCAGCGCCTGACTTGTCTCGTAATATTGCGGTACAAGACCTAAACATTGAAAACATGGGCATCAACCC
GTTGGTCGACCAGTTCTCATGGTTGATTGCCAGCTTATCTTGTATGTCTTCGATTCCTTGGCTTGATGAC
CCAATGCCGTTTCGTGAACAAGTAGCTCGTGAGATAAGAAAAGGCGAGCGTAAGCTCAATGAAATGGAAC
TGGATCGCGCATCCATTTTGGTCATCCGCTACTGTTTGTGTGCTGCGATTGATGAGTCGGTCTGCCGACA
AGAGTGGGGCGCTAACAGCCATTGGAGCCAGAACAGTTTGCTGTCAGAGTTCCACAACGAAACATCCGGC
GGCGATAAGTTTTTCGTCATTCTTGAGCGATTAAAAGCAGACCCGCGCAAATACCGTCACGTTATCGAGT
TTCTGTATTTGTTGCTTCAACTTGGCTTTCAGGGCAAATATGGCCGTGAAGAGCGCGGTAACGAAAAGCT
AGCAGAAATCGGCAATACAATTTATCGCTTAGTACGTGATGAACGCTTAGCAGAGCAAGAGAAAGTCTCT
CTCGTTAACCTTAAGGCCAAATACCTTAAGAAGCCGTTAAAAAGGGTGATTTCACCCAAACTGATTTTAG
GCGTCAGTGCGATTACCTTCGCAATCATGTATGCCGCGACTTACATCGTCATAGATTTAAAGTTTCAGCA
ATTACTTGAAGTGTATCGATAA