SecReT6
Protein ID: 436841875
SecReT6 ID721
T6SS typei1
Gene symbol-
Locus tagDESAM_21879
StrainDesulfovibrio hydrothermalis AM13 = DSM 14728
Repliconchromosome [GenBank: NC_020055] [Browse all T6SS(s) in this replicon]
Location [Strand]2268541..2269023 [+]
ProductType VI secretion protein, VC_A0107 family
NoteTssB
UniProt IDL0RD50
KEGG IDdhy:DESAM_21879
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 8.60E-57, Aligned region: 5..158
Protein Sequence: 160 a.a.     [Download]
>gi|436841875|ref|YP_007326253.1| Type VI secretion protein, VC_A0107 family [Desulfovibrio hydrothermalis AM13 = DSM 14728]
MAKEGSVAPKERVNIVYKPETGNAKEEVELPLKLLVIGDFSQKDDDSMVEDRDPVNIDKDNFNEVLKAQD
LELTLGVDNKLTDEADAQMAVNLKFESLKDFDPDRIIKQVPELQKLMELREALKALKSPLSNVPEFRKKV
QSLVKDAGARERLLKELGIE
 
Nucleotide Sequence: 483 bp     [Download]
>gi|436839709|ref|NC_020055.1|:2268541-2269023 Desulfovibrio hydrothermalis AM13 = DSM 14728 chromosome, complete genome
ATGGCAAAAGAAGGCTCAGTAGCCCCCAAAGAAAGGGTGAACATAGTTTATAAACCGGAAACAGGTAACG
CTAAAGAAGAAGTTGAACTTCCTCTTAAGCTCTTGGTCATTGGGGATTTCTCCCAAAAGGATGATGACAG
CATGGTCGAGGACCGTGATCCCGTTAACATTGATAAAGATAATTTTAACGAGGTGCTTAAAGCTCAGGAT
CTGGAGCTTACGCTTGGAGTTGATAATAAACTCACTGATGAAGCTGACGCACAGATGGCTGTGAATCTTA
AGTTTGAAAGTCTAAAGGATTTTGACCCTGACCGGATAATTAAACAGGTTCCTGAATTGCAGAAGCTTAT
GGAACTGCGTGAAGCTTTAAAGGCACTTAAAAGTCCGCTCTCCAACGTGCCGGAGTTCAGGAAGAAGGTG
CAGAGTCTGGTTAAGGATGCCGGAGCACGTGAACGTCTGCTTAAAGAACTTGGAATCGAGTAA