SecReT6
Protein ID: 436841876
SecReT6 ID721
T6SS typei1
Gene symbol-
Locus tagDESAM_21880
StrainDesulfovibrio hydrothermalis AM13 = DSM 14728
Repliconchromosome [GenBank: NC_020055] [Browse all T6SS(s) in this replicon]
Location [Strand]2269034..2270518 [+]
ProductType VI secretion protein, EvpB/VC_A0108 family
NoteTssC
UniProt IDL0RBI3
KEGG IDdhy:DESAM_21880
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.10E-185, Aligned region: 67..492
Protein Sequence: 494 a.a.     [Download]
>gi|436841876|ref|YP_007326254.1| Type VI secretion protein, EvpB/VC_A0108 family [Desulfovibrio hydrothermalis AM13 = DSM 14728]
MAEEKLKQQQEAAETTTEGSLLDDIVEATKLKPEDEAYSVTKAGLQAFLEEMVKPEREGAKVSGGLVDDM
LAQIDKKLSSQMDSIIHNKEFQQLESSWRSLKFLVDRTNFRENVRIQMMNVSKQDLLDDFDDAPEITKSG
LYKQAYTAEYGQFGGQPFGAIIGNYDFGPGPQDMKLLQYTASVAAMTHAPFIAAAGTEFFGIEKWSELPN
LKDLKSIFEMPQYAKWNSFRESDDARNVGLTLPKFLLRLPYGPDTLPAKSFNYQESVIDGDDDFCWGNTA
FAFASKLTDSFAKYRWCANIIGPQGGGAVEDLPLYQYEAMGAVQTKIPTQVLLSERREFELAEEGFIGLT
MRKGSDNAAFFSANSTQKPKFFGTSKEGKEAELNYKLSTQLPYMMIMDRLAHYIKVIQRENIGTWKERGD
LERELNTWISQYVTEMDNPAPSVRSRRPLRMAKIEVSDVEGDPGWYQVSLKARPHFKYMGAAFTLSLVGK
LEKE
 
Nucleotide Sequence: 1485 bp     [Download]
>gi|436839709|ref|NC_020055.1|:2269034-2270518 Desulfovibrio hydrothermalis AM13 = DSM 14728 chromosome, complete genome
ATGGCTGAAGAAAAACTTAAACAACAGCAAGAGGCTGCCGAAACTACGACAGAAGGCTCTTTGCTGGACG
ATATTGTTGAAGCAACGAAGCTAAAGCCGGAGGATGAAGCCTATTCGGTGACCAAGGCAGGGCTTCAGGC
TTTCCTTGAAGAGATGGTTAAGCCGGAGCGTGAAGGAGCTAAGGTCTCCGGCGGTCTTGTGGATGATATG
CTGGCTCAGATTGATAAGAAGCTTTCATCTCAGATGGACAGCATTATCCATAACAAAGAATTTCAGCAGC
TCGAATCCTCGTGGCGATCGCTTAAATTTTTGGTTGACCGTACTAATTTCCGGGAAAATGTCCGCATTCA
GATGATGAACGTTTCCAAGCAGGATTTGCTTGATGACTTTGATGATGCGCCGGAAATTACTAAGTCCGGT
CTTTATAAGCAAGCCTACACCGCAGAGTACGGACAGTTCGGCGGACAGCCTTTCGGGGCGATTATCGGTA
ATTATGACTTCGGTCCCGGCCCGCAGGATATGAAACTTTTGCAGTATACGGCATCCGTTGCCGCTATGAC
TCATGCGCCTTTTATTGCCGCAGCCGGTACTGAGTTTTTCGGTATTGAGAAGTGGAGCGAACTGCCAAAT
CTGAAAGACCTGAAGTCTATTTTTGAAATGCCGCAGTATGCCAAGTGGAACTCTTTCCGTGAATCTGATG
ATGCCAGAAACGTCGGGCTGACATTGCCCAAGTTTTTGCTCAGGCTCCCTTACGGACCGGATACCCTCCC
TGCGAAAAGTTTTAATTATCAGGAATCCGTAATTGACGGAGATGACGATTTTTGCTGGGGAAATACAGCT
TTTGCCTTTGCATCGAAGCTGACTGACTCTTTTGCAAAATATCGCTGGTGTGCCAATATTATCGGTCCGC
AGGGCGGCGGCGCAGTGGAGGATCTTCCGCTCTATCAATACGAAGCTATGGGGGCTGTCCAGACTAAGAT
TCCTACTCAGGTGCTTTTGTCAGAGCGCAGAGAGTTTGAGCTGGCGGAAGAAGGTTTTATCGGACTGACT
ATGCGTAAGGGCAGTGATAATGCAGCATTCTTCTCAGCCAACTCTACGCAGAAGCCGAAGTTCTTCGGCA
CAAGTAAGGAAGGCAAGGAAGCAGAGCTTAATTATAAACTTTCCACGCAGCTTCCCTATATGATGATCAT
GGATCGTCTGGCTCATTATATTAAAGTTATCCAGCGTGAGAACATCGGGACATGGAAAGAACGCGGTGAT
CTTGAGCGTGAGCTTAATACGTGGATTTCGCAGTATGTCACAGAAATGGACAATCCTGCACCTAGTGTCC
GCAGCCGCAGACCGCTTCGCATGGCTAAAATTGAAGTCAGCGATGTGGAAGGAGATCCGGGCTGGTATCA
GGTTTCTCTGAAAGCCCGTCCGCATTTCAAATATATGGGAGCAGCTTTCACCCTTTCACTGGTTGGTAAG
CTGGAAAAGGAATAG