SecReT6
Protein ID: 436841877
SecReT6 ID721
T6SS typei1
Gene symbolhcpC
Locus tagDESAM_21881
StrainDesulfovibrio hydrothermalis AM13 = DSM 14728
Repliconchromosome [GenBank: NC_020055] [Browse all T6SS(s) in this replicon]
Location [Strand]2270607..2271089 [+]
ProductMajor exported protein
NoteTssD
UniProt IDL0RBL4
KEGG IDdhy:DESAM_21881
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.50E-37, Aligned region: 6..146
Protein Sequence: 160 a.a.     [Download]
>gi|436841877|ref|YP_007326255.1| Major exported protein [Desulfovibrio hydrothermalis AM13 = DSM 14728]
MALTSYMKITGKTQGQIKGDCTQTGDKKDSMLVYAVEHNVEIPKDTHTGLPTGQRIHKPFEVTKHVDNAS
PKLAQACCKGEQLTVEIDYYHIDPTGIEKKYYTVKMEEAIIVNLKHYKPITFVEENKAFHDMEEVSFTYS
KITWTYADGNIEYTDDWKSS
 
Nucleotide Sequence: 483 bp     [Download]
>gi|436839709|ref|NC_020055.1|:2270607-2271089 Desulfovibrio hydrothermalis AM13 = DSM 14728 chromosome, complete genome
ATGGCTTTAACTTCGTACATGAAAATAACAGGAAAGACTCAGGGACAGATTAAAGGCGATTGTACTCAAA
CTGGCGATAAGAAAGACTCCATGCTTGTCTATGCCGTTGAGCATAATGTTGAAATCCCCAAAGATACCCA
CACCGGCCTGCCGACAGGGCAGCGTATTCATAAGCCTTTCGAGGTTACCAAGCATGTGGATAATGCTTCT
CCGAAGCTGGCTCAGGCTTGCTGTAAAGGCGAGCAGCTGACGGTTGAAATTGACTACTATCATATCGATC
CCACTGGTATTGAAAAGAAATACTACACAGTCAAAATGGAAGAGGCGATCATCGTCAACCTCAAACATTA
TAAACCGATAACTTTTGTGGAAGAAAATAAAGCTTTTCATGACATGGAGGAAGTAAGCTTTACCTATTCC
AAAATTACCTGGACCTACGCGGACGGTAATATCGAATACACTGACGACTGGAAATCAAGCTAA