SecReT6
Protein ID: 436841878
SecReT6 ID721
T6SS typei1
Gene symbol-
Locus tagDESAM_21882
StrainDesulfovibrio hydrothermalis AM13 = DSM 14728
Repliconchromosome [GenBank: NC_020055] [Browse all T6SS(s) in this replicon]
Location [Strand]2271142..2271561 [+]
ProductType VI secretion system lysozyme-related protein
NoteTssE
UniProt IDL0RD77
KEGG IDdhy:DESAM_21882
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.60E-17, Aligned region: 27..120
Protein Sequence: 139 a.a.     [Download]
>gi|436841878|ref|YP_007326256.1| Type VI secretion system lysozyme-related protein [Desulfovibrio hydrothermalis AM13 = DSM 14728]
MNEQRLLERIRYMEQEPDSRDTAEPGQVVKSILDYLRMILNTRQGNAQIAPDFGVPDFTSMIGSTGLDAV
RDIEESMTEVILKYEPRLENVKIEFIPEEDMPLSLQFKLQAKLALDDQEVPVVFETVLDPDGRIMVLDS
 
Nucleotide Sequence: 420 bp     [Download]
>gi|436839709|ref|NC_020055.1|:2271142-2271561 Desulfovibrio hydrothermalis AM13 = DSM 14728 chromosome, complete genome
TTGAACGAGCAGCGGTTACTTGAGCGCATACGGTATATGGAACAGGAACCGGACAGTCGCGATACGGCTG
AACCGGGGCAGGTTGTCAAATCCATACTTGATTACTTGCGCATGATCCTTAATACGCGGCAGGGCAATGC
TCAGATTGCCCCTGATTTCGGAGTGCCGGATTTTACTTCTATGATCGGTTCGACCGGCCTTGATGCCGTA
CGCGATATTGAGGAATCAATGACCGAGGTTATATTGAAGTACGAACCACGGCTGGAAAATGTGAAAATTG
AATTTATTCCCGAAGAAGACATGCCCCTGTCTCTCCAGTTCAAGCTTCAAGCTAAGCTTGCACTTGATGA
TCAGGAGGTTCCTGTTGTCTTTGAAACAGTGCTCGATCCTGATGGACGAATTATGGTTCTGGATAGCTAA