SecReT6
Protein ID: 436841879
SecReT6 ID721
T6SS typei1
Gene symbol-
Locus tagDESAM_21883
StrainDesulfovibrio hydrothermalis AM13 = DSM 14728
Repliconchromosome [GenBank: NC_020055] [Browse all T6SS(s) in this replicon]
Location [Strand]2271565..2273295 [+]
ProductType VI secretion protein, VC_A0110 family
NoteTssF
UniProt IDL0RF22
KEGG IDdhy:DESAM_21883
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.80E-179, Aligned region: 3..576
Protein Sequence: 576 a.a.     [Download]
>gi|436841879|ref|YP_007326257.1| Type VI secretion protein, VC_A0110 family [Desulfovibrio hydrothermalis AM13 = DSM 14728]
MIEKYYQQELAHLRELAVEFSKTHPALAPMLTGPGSDPDVERLLEGSAFMSGMINQKLDDEFPEIVHGLV
QLVFPHYLRPIPSTTIIKFIPKPSLMETIKVASGVQLASIPVNDTPCTFSTTFDVDLHPLTITKVDLAQR
AGTSGTLTIGLELKGMTLDEWDISKLRFHLTGDAAVASVRYKILFDCIRGLRVSSPGGSVAMLGARNLKA
VGFEDEEALLPYPSQSFPGYRILQEYFILPEKFLFFDIDGLDNWKNRGDGKSFEIVLELDRLPSDLIRFN
REHLCLFATPAINLFQRDAEPIILDHKRPEYQVRPSGDSGGEYQVYSVDSVVGYIQGTVEERPYKPFQMF
NPQAEEMPVYTVHHRRSVVRENTDIFLSVAYSSQGKEPRLETLSMSLTCTNGTAAEKLRYGDISKPTETS
PELASFENIRQPTSPVQPPLGNNLLWRLLSHLYINYLSVADVESLRAMVKLYVFTDTRDRGSVVANTKRV
EALTGLEVTEDDRLVRGVVMRGREIKMSLTCDGFANSGDMYLFSSVMNRFFSGYASVNCFTRLTVEDTLN
KELYQWNAMIGDRPLL
 
Nucleotide Sequence: 1731 bp     [Download]
>gi|436839709|ref|NC_020055.1|:2271565-2273295 Desulfovibrio hydrothermalis AM13 = DSM 14728 chromosome, complete genome
ATGATCGAAAAGTACTACCAACAAGAACTGGCACACCTGCGTGAGCTGGCTGTCGAGTTTTCAAAGACCC
ATCCTGCGCTGGCTCCCATGCTTACCGGACCGGGGTCTGATCCTGATGTGGAAAGACTTCTGGAAGGTTC
CGCCTTTATGTCCGGTATGATCAACCAGAAGCTCGACGATGAGTTTCCGGAAATTGTTCATGGACTTGTG
CAGCTTGTTTTTCCGCATTATCTGCGGCCTATTCCGTCTACAACTATTATTAAATTTATTCCCAAGCCAA
GCCTTATGGAGACCATTAAGGTTGCATCCGGTGTTCAGCTTGCCTCCATTCCGGTCAACGATACTCCGTG
TACTTTTTCCACTACTTTTGATGTGGATCTTCACCCGTTGACGATTACAAAAGTTGATCTTGCTCAGCGG
GCGGGAACCTCCGGAACGCTTACTATCGGTTTAGAACTCAAAGGGATGACGCTGGATGAATGGGATATTT
CAAAGCTGCGTTTTCATTTGACTGGTGACGCAGCAGTTGCCTCTGTCCGCTATAAAATCCTTTTTGATTG
CATTCGGGGTCTCCGGGTCAGTTCTCCGGGGGGATCAGTGGCAATGCTTGGGGCGCGCAATCTAAAGGCA
GTAGGGTTTGAGGATGAAGAGGCTTTATTGCCATATCCTTCGCAATCTTTTCCGGGCTACCGCATTTTGC
AGGAGTATTTCATACTTCCTGAGAAGTTCTTATTTTTTGATATTGACGGGCTGGATAACTGGAAAAACAG
GGGAGACGGGAAGAGTTTTGAGATAGTTCTGGAACTTGACCGGCTGCCATCGGACCTTATCCGCTTTAAC
CGGGAGCACCTGTGTCTGTTTGCAACGCCTGCTATCAACCTTTTTCAGCGTGACGCCGAGCCGATAATTC
TTGACCATAAACGTCCTGAATATCAGGTCCGTCCCTCCGGGGATTCAGGTGGGGAATATCAGGTTTATTC
CGTTGACTCGGTCGTCGGTTATATTCAGGGAACGGTTGAGGAACGGCCTTACAAGCCGTTTCAGATGTTT
AATCCGCAGGCTGAAGAAATGCCAGTGTACACTGTACATCATCGCCGCTCGGTTGTCAGAGAGAATACTG
ATATTTTTCTTTCAGTTGCGTATTCTTCGCAAGGTAAAGAGCCGCGTCTTGAAACCTTGTCTATGTCGCT
GACCTGTACCAACGGAACTGCTGCTGAAAAGTTGCGTTACGGTGATATTTCAAAGCCGACTGAAACTTCT
CCGGAACTGGCCTCTTTTGAAAATATCCGTCAGCCCACTTCGCCTGTTCAGCCTCCTCTTGGTAACAATC
TGCTTTGGCGGCTGTTATCTCATCTGTATATTAATTATCTTTCCGTGGCTGATGTTGAGAGCCTGCGCGC
AATGGTCAAGCTTTATGTTTTTACCGATACCCGTGACCGCGGATCAGTGGTGGCTAACACTAAAAGAGTT
GAAGCTTTAACGGGGCTGGAAGTGACAGAGGATGACCGTCTGGTGCGCGGAGTGGTTATGCGTGGGCGCG
AAATCAAGATGTCCCTTACCTGTGACGGCTTTGCTAACAGCGGTGATATGTATCTTTTCAGTTCGGTGAT
GAACCGCTTTTTTTCGGGTTATGCTTCGGTTAATTGTTTTACCCGTTTGACCGTGGAAGATACCTTAAAC
AAGGAGTTGTATCAGTGGAATGCGATGATCGGCGATCGTCCGCTTCTGTAA