SecReT6
Protein ID: 436841880
SecReT6 ID721
T6SS typei1
Gene symbol-
Locus tagDESAM_21884
StrainDesulfovibrio hydrothermalis AM13 = DSM 14728
Repliconchromosome [GenBank: NC_020055] [Browse all T6SS(s) in this replicon]
Location [Strand]2273259..2274302 [+]
ProductType VI secretion protein, VC_A0111 family
NoteTssG
UniProt IDL0RD56
KEGG IDdhy:DESAM_21884
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.00E-73, Aligned region: 18..320
Protein Sequence: 347 a.a.     [Download]
>gi|436841880|ref|YP_007326258.1| Type VI secretion protein, VC_A0111 family [Desulfovibrio hydrothermalis AM13 = DSM 14728]
MECDDRRSSASVTGRLLDNPEEYSFFQAIRLLRLHSGACTGKDLETFFRDYLRVRPQLSLGFPATDLTDL
EEEALEDGDRYRLETTFMGLYGASSPLPVFYTEELLTEASDDKSVTRDFIDIINNGVYVQFFKAWSRSRL
MIKAVDERDSSWLERLNCLLGLGHKENLAVIPEECRRYRHIGLLTQYPRSALGLNTLLKDSLQHNNVRVE
QCVLRKVKLPEDQRFSLGVSSNVLGEESLVGEELEDRTSKCAIVIRDLDAARYHQLLPGDGDGEVLDNLV
RGYLVEPFKYDLILEMRPGEAKTAVLGGDQWSGLGCDTWIFSGGHLEHAAATFPNEGGHVHSADSTL
 
Nucleotide Sequence: 1044 bp     [Download]
>gi|436839709|ref|NC_020055.1|:2273259-2274302 Desulfovibrio hydrothermalis AM13 = DSM 14728 chromosome, complete genome
GTGGAATGCGATGATCGGCGATCGTCCGCTTCTGTAACAGGAAGGCTGCTTGATAATCCTGAGGAGTATT
CTTTTTTTCAGGCTATCCGTTTGCTGCGCCTGCATTCCGGGGCGTGTACCGGCAAAGATCTGGAAACTTT
TTTCCGCGATTATCTTCGGGTGCGTCCGCAGCTTTCACTGGGATTTCCGGCGACAGACTTAACCGATCTG
GAAGAGGAGGCTCTTGAGGATGGTGACCGTTACCGTCTGGAAACAACCTTTATGGGATTGTATGGTGCTT
CGTCTCCGCTGCCGGTTTTTTATACTGAAGAACTGCTTACTGAAGCATCGGATGACAAATCGGTCACCAG
AGATTTTATCGATATCATAAATAATGGTGTCTATGTCCAGTTTTTCAAAGCATGGAGCAGATCACGGCTG
ATGATCAAGGCCGTTGATGAACGCGACAGCTCATGGCTGGAACGTTTGAACTGCCTGCTTGGTTTGGGGC
ACAAAGAAAACCTTGCTGTCATACCGGAAGAATGCCGCCGTTATCGCCATATAGGACTTTTGACTCAATA
TCCAAGGAGTGCGCTGGGGCTTAATACTTTGCTCAAGGATTCGCTTCAGCACAATAATGTGCGGGTGGAG
CAATGTGTTTTGCGCAAAGTGAAACTTCCGGAGGATCAACGTTTTTCACTTGGTGTGAGTTCCAATGTGC
TGGGAGAGGAGTCTCTGGTCGGGGAAGAGCTTGAAGACCGCACTAGTAAATGTGCCATTGTCATTCGCGA
TCTGGATGCTGCGAGGTATCACCAGTTATTACCCGGAGATGGTGACGGTGAAGTTCTGGATAATCTTGTG
CGCGGTTACCTGGTGGAACCTTTTAAATATGATCTCATCCTTGAAATGCGGCCCGGCGAAGCTAAGACGG
CTGTTCTCGGTGGCGATCAGTGGTCCGGTCTGGGATGCGATACGTGGATTTTTTCCGGCGGTCATCTCGA
ACATGCTGCGGCTACTTTCCCCAATGAAGGGGGACATGTTCATTCTGCCGATTCAACGCTGTAA