SecReT6
Protein ID: 436841881
SecReT6 ID721
T6SS typei1
Gene symbolclpV
Locus tagDESAM_21885
StrainDesulfovibrio hydrothermalis AM13 = DSM 14728
Repliconchromosome [GenBank: NC_020055] [Browse all T6SS(s) in this replicon]
Location [Strand]2274332..2276962 [+]
ProductProtein ClpV1
NoteTssH
UniProt IDL0RBI7
KEGG IDdhy:DESAM_21885
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 5.00E-42, Aligned region: 224..243
AAA_2 [PF07724], Evalue: 5.00E-42, Aligned region: 518..548
AAA_2 [PF07724], Evalue: 5.00E-42, Aligned region: 607..772
AAA [PF00004], Evalue: 1.20E-20, Aligned region: 224..355
AAA [PF00004], Evalue: 1.20E-20, Aligned region: 612..736
ClpB_D2-small [PF10431], Evalue: 1.30E-15, Aligned region: 512..538
ClpB_D2-small [PF10431], Evalue: 1.30E-15, Aligned region: 778..850
AAA_5 [PF07728], Evalue: 1.70E-13, Aligned region: 224..244
AAA_5 [PF07728], Evalue: 1.70E-13, Aligned region: 611..730
AAA_16 [PF13191], Evalue: 1.70E-13, Aligned region: 201..245
AAA_16 [PF13191], Evalue: 1.70E-13, Aligned region: 268..302
AAA_16 [PF13191], Evalue: 1.70E-13, Aligned region: 475..534
AAA_16 [PF13191], Evalue: 1.70E-13, Aligned region: 602..652
AAA_22 [PF13401], Evalue: 2.00E-08, Aligned region: 223..304
AAA_22 [PF13401], Evalue: 2.00E-08, Aligned region: 349..384
AAA_22 [PF13401], Evalue: 2.00E-08, Aligned region: 609..705
Sigma54_activat [PF00158], Evalue: 9.40E-06, Aligned region: 204..238
Sigma54_activat [PF00158], Evalue: 9.40E-06, Aligned region: 611..734
AAA_19 [PF13245], Evalue: 6.60E-05, Aligned region: 221..244
AAA_19 [PF13245], Evalue: 6.60E-05, Aligned region: 473..491
AAA_19 [PF13245], Evalue: 6.60E-05, Aligned region: 609..642
AAA_25 [PF13481], Evalue: 9.80E-05, Aligned region: 224..248
AAA_25 [PF13481], Evalue: 9.80E-05, Aligned region: 280..322
AAA_25 [PF13481], Evalue: 9.80E-05, Aligned region: 452..519
AAA_25 [PF13481], Evalue: 9.80E-05, Aligned region: 609..629
AAA_17 [PF13207], Evalue: 0.0001, Aligned region: 224..278
AAA_17 [PF13207], Evalue: 0.0001, Aligned region: 471..489
AAA_17 [PF13207], Evalue: 0.0001, Aligned region: 610..646
AAA_18 [PF13238], Evalue: 0.00014, Aligned region: 224..247
AAA_18 [PF13238], Evalue: 0.00014, Aligned region: 612..646
Zeta_toxin [PF06414], Evalue: 0.00016, Aligned region: 219..246
Zeta_toxin [PF06414], Evalue: 0.00016, Aligned region: 431..454
Zeta_toxin [PF06414], Evalue: 0.00016, Aligned region: 481..510
Zeta_toxin [PF06414], Evalue: 0.00016, Aligned region: 604..651
Arch_ATPase [PF01637], Evalue: 0.00021, Aligned region: 202..241
Arch_ATPase [PF01637], Evalue: 0.00021, Aligned region: 277..307
Arch_ATPase [PF01637], Evalue: 0.00021, Aligned region: 462..526
Arch_ATPase [PF01637], Evalue: 0.00021, Aligned region: 610..623
Arch_ATPase [PF01637], Evalue: 0.00021, Aligned region: 682..693
IstB_IS21 [PF01695], Evalue: 0.0003, Aligned region: 218..242
IstB_IS21 [PF01695], Evalue: 0.0003, Aligned region: 611..647
IstB_IS21 [PF01695], Evalue: 0.0003, Aligned region: 721..740
MobB [PF03205], Evalue: 0.00063, Aligned region: 225..246
MobB [PF03205], Evalue: 0.00063, Aligned region: 461..535
MobB [PF03205], Evalue: 0.00063, Aligned region: 610..643
AAA_14 [PF13173], Evalue: 0.0013, Aligned region: 276..304
AAA_14 [PF13173], Evalue: 0.0013, Aligned region: 610..699
DUF258 [PF03193], Evalue: 0.0026, Aligned region: 206..241
DUF258 [PF03193], Evalue: 0.0026, Aligned region: 611..652
NACHT [PF05729], Evalue: 0.0054, Aligned region: 224..251
NACHT [PF05729], Evalue: 0.0054, Aligned region: 283..323
NACHT [PF05729], Evalue: 0.0054, Aligned region: 418..443
NACHT [PF05729], Evalue: 0.0054, Aligned region: 611..623
Protein Sequence: 876 a.a.     [Download]
>gi|436841881|ref|YP_007326259.1| Protein ClpV1 [Desulfovibrio hydrothermalis AM13 = DSM 14728]
MISVDIKNLLSKLNTYSTNALHNAAGLCVSLTHYEVSVEHYFLKCLEDVNSDLPIIMHQYGVETSRLTAS
LSDVLEDFKSGNSGKPVFSPMLIELFEDAWLISSVELGDTRIRSGAVLLAFLSKPNFYASGAYSSLLSEV
SRDSLIKEFWSITKSSVEYKLPAAERGGSGPAGAAKGDGGFLERFCVDFTAKAKEGGIDPVFGRDAEMRQ
MVDILARRRKNNPILVGEPGVGKTAVIEGLALRITEGDVPEILSGVSLIGLDMGLLEAGAGMKGEFENRL
KGVIDEIKSSEKPIILFIDEAHTLVGAGGSTGGSDAANLLKPALARGELKTCAATTWTEYKKYFEKDPAL
ARRFQLVKLDEPSVETSTIILRGLRDSYEKSHKVIIRDDACVSAAVFSDRYIAGRFLPDKAIDLLDTTCA
RVKVNLSAKPAQLEDCERTVQALEREKKAVDRDRLNGVAVDESRYREVDEMIASKTKEADQIRERWLKEK
DAAHAVLDARQQVQAAGDDKAEVKKLKKELAKADKALARLQVDEALVQIEVSPDLVGRVVSDWTGIPVGK
MARDEAKTVVDLDIRLQQRVKGQDQGLAAIAEVIRASKAGIKNPDQPIGVFLIVGPSGVGKTETGLSLAD
LLFGDERSVVTVNMSEFQEKHTVSRLIGSPPGYVGYGEGGMLTEAVRRQPYSVVLLDEVEKAHLDVMNTF
YQVFDKGILTDGEGKDINFKNTIIILTSNLATDVIQEMTGGEDEMPLEAVTSAVRPILSQHFKPALLARM
NVVPYVSLNPEAMKLITRLKLGKLEKMLFNNNKMKLSYDEAVVDQIAARCTEVETGARNIEYILNGNVLP
QMSKEILGHMTEGGMPSAVHLSVAEDGSFSMEFSRD
 
Nucleotide Sequence: 2631 bp     [Download]
>gi|436839709|ref|NC_020055.1|:2274332-2276962 Desulfovibrio hydrothermalis AM13 = DSM 14728 chromosome, complete genome
ATGATAAGTGTCGATATAAAAAATCTGCTTTCCAAACTCAATACTTACAGCACCAATGCTTTGCATAATG
CCGCGGGGCTTTGTGTATCGCTTACTCATTACGAAGTGTCGGTGGAGCACTATTTTCTGAAATGTCTGGA
GGATGTTAATAGCGATCTGCCTATTATCATGCATCAGTACGGCGTTGAAACCTCCCGTCTCACAGCGTCA
CTTTCTGATGTGCTGGAAGATTTTAAGTCCGGTAATTCCGGTAAACCTGTTTTTTCGCCCATGCTTATCG
AACTTTTTGAAGATGCATGGCTTATCTCTTCCGTTGAACTGGGGGATACCCGCATCCGCTCCGGAGCAGT
GCTGCTGGCCTTTTTATCTAAGCCTAATTTCTATGCTTCCGGGGCATATTCTAGTCTGCTTTCTGAAGTC
AGTCGCGATTCTTTGATTAAAGAATTCTGGAGTATTACTAAATCATCTGTGGAATACAAACTTCCCGCTG
CCGAGCGTGGCGGAAGCGGGCCGGCAGGAGCAGCAAAAGGTGATGGAGGATTCCTTGAACGCTTTTGTGT
TGATTTCACTGCCAAGGCGAAAGAAGGCGGGATTGACCCTGTTTTCGGCCGTGATGCTGAAATGCGTCAG
ATGGTGGATATTCTGGCTCGCCGCCGTAAGAATAATCCGATCCTTGTAGGTGAACCCGGTGTAGGCAAGA
CAGCTGTAATTGAGGGACTGGCTCTGCGTATCACTGAAGGAGATGTTCCTGAAATTCTCAGCGGCGTATC
GCTTATCGGCTTGGACATGGGCCTGCTTGAAGCAGGGGCCGGTATGAAAGGTGAGTTTGAGAACCGTCTT
AAAGGCGTAATTGATGAGATCAAGTCCAGTGAAAAGCCGATCATTTTGTTTATCGATGAAGCTCACACCT
TAGTGGGGGCGGGCGGTTCAACAGGGGGATCTGATGCGGCTAATCTGCTCAAGCCAGCCCTTGCACGCGG
GGAGCTTAAAACCTGCGCGGCAACGACATGGACTGAATATAAAAAGTATTTTGAGAAAGATCCTGCCTTG
GCCCGCCGTTTTCAGCTGGTAAAGCTTGATGAACCGTCAGTTGAGACTTCGACCATTATATTACGCGGTC
TGCGTGACAGCTATGAAAAATCGCATAAGGTTATTATTCGTGATGATGCTTGTGTTTCAGCCGCTGTTTT
TTCTGATCGTTATATCGCAGGACGTTTTCTGCCTGATAAGGCGATTGATTTGCTGGATACAACTTGCGCC
CGTGTCAAAGTTAACCTTTCTGCCAAGCCGGCGCAGCTTGAAGATTGCGAACGTACTGTGCAGGCCCTTG
AGCGCGAGAAAAAGGCTGTGGACCGTGACCGGTTAAACGGCGTTGCGGTTGATGAATCCCGCTACAGGGA
AGTGGATGAAATGATTGCTTCCAAAACTAAAGAAGCGGATCAGATCCGTGAACGCTGGCTTAAGGAGAAA
GACGCGGCTCACGCTGTGCTTGATGCACGGCAGCAGGTTCAGGCCGCCGGGGATGATAAGGCAGAAGTTA
AGAAACTCAAAAAAGAGCTGGCTAAAGCTGACAAAGCCCTTGCAAGACTGCAAGTTGATGAAGCTCTGGT
GCAGATTGAGGTTTCCCCTGATCTGGTGGGGCGGGTTGTTTCGGACTGGACTGGAATTCCGGTGGGTAAA
ATGGCTCGTGATGAGGCTAAAACAGTGGTCGACCTTGATATCCGCCTTCAGCAGCGAGTCAAGGGTCAGG
ATCAGGGGCTTGCTGCCATTGCCGAAGTTATTCGCGCTTCAAAGGCCGGAATTAAGAATCCTGATCAGCC
TATCGGCGTATTTTTGATAGTCGGGCCGTCAGGTGTCGGTAAAACTGAAACTGGCTTATCGCTTGCGGAT
CTGCTTTTCGGTGATGAACGGTCGGTGGTGACTGTCAACATGAGTGAATTTCAGGAAAAGCATACGGTCT
CCCGGCTTATAGGTTCTCCTCCGGGCTATGTCGGCTATGGAGAAGGCGGCATGCTTACCGAAGCTGTGCG
TCGTCAGCCCTACAGCGTTGTGCTGCTTGACGAAGTGGAAAAGGCCCATCTGGATGTTATGAACACTTTT
TATCAGGTTTTTGACAAAGGTATTCTCACCGATGGTGAAGGCAAGGATATCAATTTCAAAAACACCATAA
TTATCCTGACTTCCAATCTGGCGACCGATGTCATTCAGGAAATGACCGGAGGCGAAGATGAAATGCCCCT
TGAGGCTGTAACTTCGGCAGTCAGGCCTATACTTTCCCAGCATTTCAAGCCGGCTCTTCTGGCTCGTATG
AATGTGGTTCCGTATGTCTCGCTTAATCCGGAAGCCATGAAACTGATCACCCGGCTCAAGCTCGGCAAAC
TTGAGAAGATGTTGTTTAATAATAACAAGATGAAACTTAGCTATGACGAAGCTGTTGTTGATCAGATCGC
GGCCCGTTGCACCGAAGTTGAAACCGGTGCTCGAAATATTGAATATATCCTGAACGGTAATGTTCTGCCG
CAGATGTCCAAAGAGATTCTTGGACATATGACCGAAGGCGGCATGCCTTCAGCCGTGCATCTCAGTGTGG
CTGAAGACGGTTCATTCTCCATGGAATTTTCCAGAGATTAG