SecReT6
Protein ID: 436841888
SecReT6 ID721
T6SS typei1
Gene symbol-
Locus tagDESAM_21892
StrainDesulfovibrio hydrothermalis AM13 = DSM 14728
Repliconchromosome [GenBank: NC_020055] [Browse all T6SS(s) in this replicon]
Location [Strand]2286205..2287752 [-]
Producthypothetical protein
NoteTssC
UniProt IDL0RD87
KEGG IDdhy:DESAM_21892
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.40E-22, Aligned region: 161..203
DUF877 [PF05943], Evalue: 1.40E-22, Aligned region: 227..423
DUF770 [PF05591], Evalue: 4.60E-08, Aligned region: 7..94
Protein Sequence: 515 a.a.     [Download]
>gi|436841888|ref|YP_007326266.1| conserved protein of unknown function [Desulfovibrio hydrothermalis AM13 = DSM 14728]
MHIEIPPFSILAIGPFSPALNTDNPPVLTIDSLSLDDAIAQLAPTIDITVAKDICPDGNIAVTVKRMADF
KPKNIARNCLFIKELLAARTYVKKGGPAADLTAKYPRVASLLTISTPTKHLKSESKSNAIDDLLSIVDTG
TSAGSTTQYFEAGSIENQVNAIHGKLLRAIFTDSNFRLMEAAWRGAELLLKQVPSGTRPTVNLKLVPLPQ
GDCLPIFDMLESTLADTPPDIILIDKPLSNTPRAMSELERIMDFAETMLAPAFIPISPKFLEISDWEELR
SVRYIPGLLEGAEYGRWKTLVTNSGAGWITPCLGGIMARPMHLPEAGFSEVGFAESSPLWSSTPWAMGAL
CAKSIAAHGRPTRFSDRSSVRLENLPLTESPSPSPLEIILDTERLADFKQAGILPLAGTPGRDHVFVTGA
ITMDGGPLKFRMFLSQLTGFLIRTSLTGRDEIENIELDLSKAVSLFIQGLGLPIPDDLKIIANENNEGTI
PLEISLTPAPEILPGNKKFTFGFNW
 
Nucleotide Sequence: 1548 bp     [Download]
>gi|436839709|ref|NC_020055.1|:c2287752-2286205 Desulfovibrio hydrothermalis AM13 = DSM 14728 chromosome, complete genome
ATGCATATAGAAATCCCCCCATTTTCAATACTGGCAATCGGTCCCTTTTCCCCAGCACTAAACACTGACA
ATCCACCAGTGTTGACAATAGATTCCCTATCATTGGACGATGCTATCGCGCAGCTTGCACCGACTATCGA
TATTACGGTGGCCAAAGATATTTGTCCGGATGGAAATATTGCGGTCACGGTTAAAAGGATGGCAGATTTC
AAACCTAAAAATATCGCCAGAAACTGCCTGTTTATTAAAGAACTCCTTGCCGCCAGAACGTATGTAAAAA
AAGGCGGCCCCGCAGCGGACTTAACAGCAAAATATCCTCGCGTCGCCAGTCTGTTAACAATTTCCACCCC
GACAAAACACCTCAAATCCGAATCCAAATCCAATGCCATAGATGACCTGTTATCCATAGTAGACACAGGA
ACATCCGCAGGCAGTACAACTCAATATTTTGAAGCTGGCAGTATTGAAAATCAGGTTAATGCAATTCACG
GCAAACTTCTGCGGGCAATATTCACAGATTCAAATTTCAGGCTTATGGAAGCAGCATGGCGAGGTGCTGA
GCTGTTACTCAAACAGGTCCCCTCCGGAACCAGGCCGACTGTTAATCTGAAACTCGTTCCTCTGCCGCAG
GGAGACTGTCTCCCGATTTTTGATATGCTGGAGTCAACACTGGCAGACACACCGCCAGACATAATTCTGA
TCGACAAACCGCTTTCCAATACCCCGCGTGCCATGTCCGAGCTGGAGCGCATTATGGACTTTGCCGAAAC
AATGCTTGCTCCGGCTTTCATTCCGATCAGTCCAAAATTCCTTGAAATCTCAGACTGGGAAGAGCTTCGC
TCTGTCCGCTACATCCCCGGCCTGCTTGAAGGGGCAGAATACGGACGCTGGAAAACGCTTGTCACAAATT
CCGGTGCAGGATGGATCACTCCATGTCTCGGAGGAATCATGGCCCGCCCCATGCACCTGCCTGAAGCAGG
GTTCAGCGAAGTTGGATTTGCAGAATCATCACCGTTATGGTCCAGCACCCCGTGGGCAATGGGAGCTTTA
TGTGCAAAAAGCATAGCAGCGCATGGCCGCCCCACCCGATTTTCCGACCGCTCCTCAGTGCGCCTTGAAA
ATCTTCCGCTAACTGAAAGTCCTTCACCATCGCCGCTTGAAATCATACTTGATACTGAAAGACTGGCAGA
TTTCAAACAGGCCGGAATTCTTCCTCTGGCCGGAACGCCGGGAAGAGATCACGTCTTTGTCACAGGAGCA
ATCACAATGGATGGCGGCCCCTTGAAATTCAGGATGTTCCTTTCCCAGCTAACCGGTTTTCTTATCCGCA
CCTCTTTGACAGGACGTGATGAAATTGAAAACATTGAGCTTGATCTAAGCAAAGCCGTTTCACTTTTCAT
TCAAGGCTTAGGACTGCCAATTCCAGATGACCTGAAAATAATTGCCAATGAAAACAATGAAGGAACAATT
CCTCTCGAAATATCTTTAACACCTGCTCCTGAAATACTTCCCGGTAACAAAAAGTTCACTTTCGGATTCA
ACTGGTAA