SecReT6
Protein ID: 436841889
SecReT6 ID721
T6SS typei1
Gene symbol-
Locus tagDESAM_21893
StrainDesulfovibrio hydrothermalis AM13 = DSM 14728
Repliconchromosome [GenBank: NC_020055] [Browse all T6SS(s) in this replicon]
Location [Strand]2287951..2288529 [+]
ProductType VI secretion lipoprotein, VC_A0113 family
NoteTssJ
UniProt IDL0RF30
KEGG IDdhy:DESAM_21893
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.70E-25, Aligned region: 15..186
Protein Sequence: 192 a.a.     [Download]
>gi|436841889|ref|YP_007326267.1| Type VI secretion lipoprotein, VC_A0113 family [Desulfovibrio hydrothermalis AM13 = DSM 14728]
MRCKCFKLFFVMLLFITVSCGGKQKPVDPTTVTTPASSPDQMKWTYQTNAISFQLNVDKNLNEYDGSPHS
LLLCVYQLTELSKFKELAGSTTGLGKLYNCTSFGPTVKQVKREFVQPGKNATISMDRAEGAKFVGIAAGY
YDLQGGGATRTWQIPMNISETGMLFWSDTWYAPAKLDAMIILGPHEIQKVGE
 
Nucleotide Sequence: 579 bp     [Download]
>gi|436839709|ref|NC_020055.1|:2287951-2288529 Desulfovibrio hydrothermalis AM13 = DSM 14728 chromosome, complete genome
ATGCGCTGTAAGTGCTTTAAACTGTTCTTTGTTATGCTTTTATTTATTACCGTAAGTTGCGGGGGTAAAC
AGAAGCCTGTTGACCCTACTACAGTAACGACTCCGGCATCCAGTCCAGATCAGATGAAATGGACCTATCA
GACTAATGCCATTTCCTTTCAATTGAATGTTGACAAAAATTTAAATGAATACGACGGATCGCCGCATTCG
CTTTTGCTGTGCGTTTACCAGTTAACGGAGTTGAGTAAGTTTAAGGAGCTGGCAGGCTCAACCACCGGGC
TGGGCAAATTATATAACTGCACAAGCTTTGGGCCTACGGTTAAACAGGTTAAACGGGAATTTGTTCAACC
CGGAAAAAATGCAACAATATCAATGGACCGGGCCGAAGGGGCGAAGTTTGTAGGTATTGCAGCCGGGTAT
TATGATCTTCAGGGTGGCGGGGCTACCCGTACATGGCAGATTCCCATGAATATATCGGAGACAGGAATGC
TTTTCTGGTCGGATACATGGTATGCTCCGGCTAAACTGGATGCCATGATAATTCTTGGTCCGCATGAGAT
ACAAAAGGTCGGGGAGTAA