SecReT6
Protein ID: 436841890
SecReT6 ID721
T6SS typei1
Gene symbol-
Locus tagDESAM_21894
StrainDesulfovibrio hydrothermalis AM13 = DSM 14728
Repliconchromosome [GenBank: NC_020055] [Browse all T6SS(s) in this replicon]
Location [Strand]2288533..2289912 [+]
ProductType VI secretion protein, VC_A0114 family
NoteTssK
UniProt IDL0RD65
KEGG IDdhy:DESAM_21894
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 5.50E-83, Aligned region: 19..451
Protein Sequence: 459 a.a.     [Download]
>gi|436841890|ref|YP_007326268.1| Type VI secretion protein, VC_A0114 family [Desulfovibrio hydrothermalis AM13 = DSM 14728]
MHANKPLFWHQGLFLQPQHFQLADLHQLHRLRAIREFGQPYFWGVTRLKIRTGALERRNFEVSDIEILFD
DGNFVCFPGNAKLEPRSFDKAWVDGEKPFMVYLGLRKWNPEGGNVSLVDDDASVVNTMFAASPDPEELPD
MLGNGPVAQVKPMRYVLRLFFENELEDLGAYTILPLARLILDVQQVRLDDSFIPPALTMRASDSLNNIFK
DISDQVASRCRRLEQYKNPAGLGAGDLDFTSTVFLLALRTLNRYAPKLKHLADAPNIHPWKAFGVLRQII
GELSSFSRDISALGEGGSGEKLVPDYDHENLGPCFEAARSIITHILDSLTAGPEFMSQFVFEDPYYTAEL
PERAFGPGNTFWLLVRTDRPDQALPEILKIAKLSATRGMSALLARAVHGIGLIHVENPPPGLPRSKGALC
FRFDTLSHLWEDVEKSRSISLYWDSAPKEMTAYIAAMRG
 
Nucleotide Sequence: 1380 bp     [Download]
>gi|436839709|ref|NC_020055.1|:2288533-2289912 Desulfovibrio hydrothermalis AM13 = DSM 14728 chromosome, complete genome
GTGCACGCTAATAAACCGCTTTTCTGGCATCAGGGATTATTTTTACAACCTCAGCATTTTCAACTGGCTG
ATCTGCACCAGTTGCATCGGCTGCGCGCAATTCGTGAATTTGGGCAGCCTTATTTCTGGGGGGTGACCCG
GTTGAAAATTCGCACGGGCGCACTTGAGCGTCGCAATTTTGAAGTCAGTGATATTGAAATTTTGTTCGAT
GACGGTAATTTTGTTTGTTTTCCCGGCAACGCAAAGCTTGAGCCTCGTTCGTTTGATAAGGCATGGGTGG
ATGGCGAGAAGCCCTTTATGGTTTATCTCGGTTTGCGGAAATGGAATCCTGAAGGCGGGAACGTTTCCCT
TGTGGATGACGATGCATCGGTTGTGAACACTATGTTTGCCGCGTCTCCCGATCCTGAAGAGTTACCCGAT
ATGCTTGGAAACGGACCTGTGGCTCAGGTCAAACCCATGCGTTATGTGCTGCGTCTTTTTTTCGAAAATG
AACTGGAAGATCTTGGAGCATATACCATACTTCCGCTGGCCCGTCTGATTCTTGATGTTCAGCAGGTCCG
TCTGGATGACAGTTTCATCCCGCCTGCTTTGACCATGAGAGCTTCGGATTCATTGAATAATATTTTTAAA
GATATAAGTGATCAGGTGGCTTCCCGTTGCCGCCGGCTGGAGCAGTATAAAAATCCGGCAGGACTCGGAG
CAGGTGATCTGGATTTCACTTCAACTGTTTTCCTGCTCGCTTTGCGAACTCTGAACCGGTATGCTCCGAA
ATTAAAGCATCTGGCTGATGCTCCTAACATCCATCCTTGGAAAGCGTTCGGTGTATTGCGCCAGATTATC
GGGGAGTTATCTTCATTTTCGCGTGATATATCTGCCCTTGGCGAAGGGGGGAGCGGTGAAAAGCTTGTAC
CTGATTATGATCATGAAAATCTGGGGCCTTGTTTCGAAGCAGCGCGGTCTATTATTACTCATATTCTTGA
CAGCCTTACTGCCGGACCTGAATTTATGAGTCAGTTCGTTTTTGAAGATCCGTATTACACCGCGGAGCTG
CCGGAACGTGCTTTCGGTCCGGGAAATACTTTCTGGCTGCTGGTCAGAACCGACCGCCCTGATCAGGCCC
TTCCGGAAATCTTAAAGATTGCCAAACTTTCAGCGACCAGAGGCATGAGTGCTTTGCTCGCCAGAGCGGT
GCATGGCATTGGATTAATTCATGTTGAGAATCCGCCTCCCGGACTTCCCCGTTCCAAGGGTGCTCTTTGT
TTCCGCTTCGATACTCTGTCTCACCTGTGGGAAGATGTTGAGAAGTCGCGCAGTATTTCACTGTACTGGG
ATTCCGCTCCTAAAGAAATGACGGCTTATATCGCGGCTATGAGAGGTTAA