SecReT6
Protein ID: 436841891
SecReT6 ID721
T6SS typei1
Gene symbol-
Locus tagDESAM_21895
StrainDesulfovibrio hydrothermalis AM13 = DSM 14728
Repliconchromosome [GenBank: NC_020055] [Browse all T6SS(s) in this replicon]
Location [Strand]2289919..2290662 [+]
ProductType IV / VI secretion system protein, DotU family
NoteTssL
UniProt IDL0RBJ7
KEGG IDdhy:DESAM_21895
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.70E-41, Aligned region: 2..112
DUF2077 [PF09850], Evalue: 5.70E-41, Aligned region: 139..235
Protein Sequence: 247 a.a.     [Download]
>gi|436841891|ref|YP_007326269.1| Type IV / VI secretion system protein, DotU family [Desulfovibrio hydrothermalis AM13 = DSM 14728]
MHLSDCFLELFTFIRFLADSPEMADAEYDAVHEDVSKLIERLEQRADKCGFAPDLFDKARFAVFAWVDEA
VLCSSWSGTRQWLRHPLQREYYGTTNAGEEFFERLDMLLDGNHVPVDESLFADLEKDSNENAPAGKIENA
NSEVLEVYTLCLSLGYTGKYFSESDTERLDKLRNDCIARIMGKQGGNGLAAFPAAYGTGEKALRTSQYGR
VFDPLSIVFIVLPVLVVAGVFFAYRGLLEYSLNLWLG
 
Nucleotide Sequence: 744 bp     [Download]
>gi|436839709|ref|NC_020055.1|:2289919-2290662 Desulfovibrio hydrothermalis AM13 = DSM 14728 chromosome, complete genome
ATGCATCTGTCAGACTGCTTTCTGGAACTCTTCACCTTTATCCGCTTTTTGGCTGATTCTCCGGAAATGG
CCGATGCAGAGTATGATGCTGTGCATGAAGATGTCTCAAAGCTTATTGAACGTCTGGAACAGAGAGCTGA
TAAATGCGGCTTTGCTCCTGATCTGTTTGATAAAGCAAGGTTTGCAGTATTTGCATGGGTGGATGAAGCT
GTACTTTGTTCTTCATGGTCAGGAACCCGTCAGTGGCTCCGGCATCCTTTGCAGAGGGAGTATTACGGCA
CGACCAATGCGGGGGAGGAGTTCTTTGAGCGTCTCGATATGCTGCTTGACGGGAATCATGTTCCTGTTGA
TGAGAGTCTTTTTGCCGATCTTGAAAAGGATTCAAATGAAAATGCACCTGCCGGTAAAATAGAAAACGCT
AATTCTGAAGTGCTAGAAGTTTATACCTTATGTCTGTCCCTTGGTTATACTGGAAAATATTTCAGCGAGT
CGGATACTGAACGTCTTGATAAGCTGCGCAATGATTGCATTGCGCGGATAATGGGGAAGCAGGGCGGCAA
CGGGCTGGCTGCTTTTCCGGCAGCGTATGGAACTGGAGAGAAAGCTCTCCGCACTTCACAATATGGTCGG
GTTTTTGATCCGCTTTCCATTGTTTTTATTGTTCTTCCGGTGCTTGTGGTGGCTGGTGTTTTTTTCGCCT
ATAGGGGCCTTCTCGAATACAGTCTCAACCTATGGTTGGGCTGA