SecReT6
Protein ID: 436841908
SecReT6 ID721
T6SS typei1
Gene symbolclpB
Locus tagDESAM_21912
StrainDesulfovibrio hydrothermalis AM13 = DSM 14728
Repliconchromosome [GenBank: NC_020055] [Browse all T6SS(s) in this replicon]
Location [Strand]2311690..2314314 [-]
Productprotein disaggregation chaperone
NoteTssH
UniProt IDL0RDA7
KEGG IDdhy:DESAM_21912
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.70E-58, Aligned region: 206..290
AAA_2 [PF07724], Evalue: 1.70E-58, Aligned region: 609..774
AAA [PF00004], Evalue: 3.10E-27, Aligned region: 208..342
AAA [PF00004], Evalue: 3.10E-27, Aligned region: 394..422
AAA [PF00004], Evalue: 3.10E-27, Aligned region: 615..733
Clp_N [PF02861], Evalue: 1.60E-25, Aligned region: 17..69
Clp_N [PF02861], Evalue: 1.60E-25, Aligned region: 97..150
ClpB_D2-small [PF10431], Evalue: 1.80E-24, Aligned region: 781..861
AAA_5 [PF07728], Evalue: 9.30E-20, Aligned region: 208..234
AAA_5 [PF07728], Evalue: 9.30E-20, Aligned region: 333..401
AAA_5 [PF07728], Evalue: 9.30E-20, Aligned region: 614..734
AAA_16 [PF13191], Evalue: 7.50E-12, Aligned region: 185..231
AAA_16 [PF13191], Evalue: 7.50E-12, Aligned region: 251..286
AAA_16 [PF13191], Evalue: 7.50E-12, Aligned region: 416..479
AAA_16 [PF13191], Evalue: 7.50E-12, Aligned region: 585..638
AAA_16 [PF13191], Evalue: 7.50E-12, Aligned region: 680..709
AAA_22 [PF13401], Evalue: 7.50E-11, Aligned region: 206..300
AAA_22 [PF13401], Evalue: 7.50E-11, Aligned region: 325..406
AAA_22 [PF13401], Evalue: 7.50E-11, Aligned region: 612..713
AAA_14 [PF13173], Evalue: 3.60E-09, Aligned region: 208..289
AAA_14 [PF13173], Evalue: 3.60E-09, Aligned region: 615..711
AAA_17 [PF13207], Evalue: 3.80E-08, Aligned region: 208..285
AAA_17 [PF13207], Evalue: 3.80E-08, Aligned region: 617..657
IstB_IS21 [PF01695], Evalue: 6.00E-08, Aligned region: 98..130
IstB_IS21 [PF01695], Evalue: 6.00E-08, Aligned region: 202..268
IstB_IS21 [PF01695], Evalue: 6.00E-08, Aligned region: 478..512
IstB_IS21 [PF01695], Evalue: 6.00E-08, Aligned region: 614..657
Sigma54_activat [PF00158], Evalue: 2.00E-07, Aligned region: 186..229
Sigma54_activat [PF00158], Evalue: 2.00E-07, Aligned region: 613..728
AAA_18 [PF13238], Evalue: 6.40E-07, Aligned region: 208..279
AAA_18 [PF13238], Evalue: 6.40E-07, Aligned region: 616..650
Arch_ATPase [PF01637], Evalue: 1.00E-06, Aligned region: 187..230
Arch_ATPase [PF01637], Evalue: 1.00E-06, Aligned region: 259..294
Arch_ATPase [PF01637], Evalue: 1.00E-06, Aligned region: 617..654
NACHT [PF05729], Evalue: 3.70E-06, Aligned region: 208..251
NACHT [PF05729], Evalue: 3.70E-06, Aligned region: 615..640
DNA_pol3_delta2 [PF13177], Evalue: 1.80E-05, Aligned region: 200..232
DNA_pol3_delta2 [PF13177], Evalue: 1.80E-05, Aligned region: 456..489
DNA_pol3_delta2 [PF13177], Evalue: 1.80E-05, Aligned region: 613..708
AAA_23 [PF13476], Evalue: 5.20E-05, Aligned region: 208..224
AAA_23 [PF13476], Evalue: 5.20E-05, Aligned region: 400..491
AAA_23 [PF13476], Evalue: 5.20E-05, Aligned region: 612..645
RNA_helicase [PF00910], Evalue: 6.30E-05, Aligned region: 209..231
RNA_helicase [PF00910], Evalue: 6.30E-05, Aligned region: 615..639
MobB [PF03205], Evalue: 7.30E-05, Aligned region: 209..236
MobB [PF03205], Evalue: 7.30E-05, Aligned region: 615..639
Zeta_toxin [PF06414], Evalue: 0.00014, Aligned region: 208..228
Zeta_toxin [PF06414], Evalue: 0.00014, Aligned region: 320..337
Zeta_toxin [PF06414], Evalue: 0.00014, Aligned region: 614..664
DUF258 [PF03193], Evalue: 0.00029, Aligned region: 203..228
DUF258 [PF03193], Evalue: 0.00029, Aligned region: 614..635
AAA_28 [PF13521], Evalue: 0.00038, Aligned region: 208..229
AAA_28 [PF13521], Evalue: 0.00038, Aligned region: 398..437
AAA_28 [PF13521], Evalue: 0.00038, Aligned region: 614..653
T2SE [PF00437], Evalue: 0.0004, Aligned region: 193..231
T2SE [PF00437], Evalue: 0.0004, Aligned region: 354..435
T2SE [PF00437], Evalue: 0.0004, Aligned region: 442..482
T2SE [PF00437], Evalue: 0.0004, Aligned region: 609..655
NTPase_1 [PF03266], Evalue: 0.00043, Aligned region: 208..233
NTPase_1 [PF03266], Evalue: 0.00043, Aligned region: 259..285
NTPase_1 [PF03266], Evalue: 0.00043, Aligned region: 617..639
MMR_HSR1 [PF01926], Evalue: 0.0011, Aligned region: 208..283
MMR_HSR1 [PF01926], Evalue: 0.0011, Aligned region: 614..634
AAA_24 [PF13479], Evalue: 0.0011, Aligned region: 208..226
AAA_24 [PF13479], Evalue: 0.0011, Aligned region: 615..704
ABC_tran [PF00005], Evalue: 0.0015, Aligned region: 38..96
ABC_tran [PF00005], Evalue: 0.0015, Aligned region: 208..226
ABC_tran [PF00005], Evalue: 0.0015, Aligned region: 431..452
ABC_tran [PF00005], Evalue: 0.0015, Aligned region: 616..648
AAA_19 [PF13245], Evalue: 0.002, Aligned region: 205..234
AAA_19 [PF13245], Evalue: 0.002, Aligned region: 615..638
UPF0079 [PF02367], Evalue: 0.0021, Aligned region: 208..228
UPF0079 [PF02367], Evalue: 0.0021, Aligned region: 616..642
ResIII [PF04851], Evalue: 0.0021, Aligned region: 192..260
ResIII [PF04851], Evalue: 0.0021, Aligned region: 273..295
ResIII [PF04851], Evalue: 0.0021, Aligned region: 458..458
ResIII [PF04851], Evalue: 0.0021, Aligned region: 587..637
Mg_chelatase [PF01078], Evalue: 0.0023, Aligned region: 193..226
Mg_chelatase [PF01078], Evalue: 0.0023, Aligned region: 477..502
Mg_chelatase [PF01078], Evalue: 0.0023, Aligned region: 613..640
AAA_30 [PF13604], Evalue: 0.0057, Aligned region: 208..228
AAA_30 [PF13604], Evalue: 0.0057, Aligned region: 413..450
AAA_30 [PF13604], Evalue: 0.0057, Aligned region: 615..643
ATP_bind_1 [PF03029], Evalue: 0.0059, Aligned region: 210..230
ATP_bind_1 [PF03029], Evalue: 0.0059, Aligned region: 617..645
AAA_25 [PF13481], Evalue: 0.0067, Aligned region: 208..271
AAA_25 [PF13481], Evalue: 0.0067, Aligned region: 614..635
Miro [PF08477], Evalue: 0.0072, Aligned region: 209..245
Miro [PF08477], Evalue: 0.0072, Aligned region: 617..649
AAA_3 [PF07726], Evalue: 0.0075, Aligned region: 209..228
AAA_3 [PF07726], Evalue: 0.0075, Aligned region: 684..731
TrwB_AAD_bind [PF10412], Evalue: 0.0077, Aligned region: 200..238
TrwB_AAD_bind [PF10412], Evalue: 0.0077, Aligned region: 613..647
SRP54 [PF00448], Evalue: 0.0086, Aligned region: 208..231
SRP54 [PF00448], Evalue: 0.0086, Aligned region: 614..642
PduV-EutP [PF10662], Evalue: 0.0092, Aligned region: 208..227
PduV-EutP [PF10662], Evalue: 0.0092, Aligned region: 614..633
Protein Sequence: 874 a.a.     [Download]
>gi|436841908|ref|YP_007326286.1| protein disaggregation chaperone [Desulfovibrio hydrothermalis AM13 = DSM 14728]
MDPNKFTKKTNDAIAAAQSLAVKNGQQQIEVEHLLLALVEQENGIVSKIIQKSDIDPSAYKSAVQKEIGK
LPSVSGPGAQPGQVLVTQRLNRIIVEAEAAAQRMQDEFISVEHLFLAIMDEHGSTGAGRVNKSFNLTKDK
VLEAMTTIRGNQRVTTDNPEATYDALKKYGRDLVEEARKGKLDPVIGRDSEIRRVIRILSRRTKNNPILI
GEAGVGKTAIIEGLAQRIVKRDVPEGLKDKTVFMLDMGALIAGAKYRGEFEERLKAVLKEVQESDGQIII
FIDEIHTIVGAGKSDGAMDAGNLLKPMLARGELHCIGATTTDEYRKYIEKDPALERRFQTIMVKEPTAED
TISILRGLRERFEVHHGVRISDAALVEAATLSQRYITDRQLPDKAIDLIDEAAAMIRTEIDSQPYELDKI
NRQILQTEIEREALRREEDQASRERLSKLEDSLTEMKIKQSELVEQWEKEKASIDTVRNLKAQIEQTKLQ
IEEAERSLDYNRAAELKYSTLLGLEKRLEEIQVDIEGGEDKASSNGSRLLKEFVGPDDIAGIISRWTGIP
VTRLVEGEREKLLRLEDILHGRVIGQDEAVRAVSEAVLRARAGLKDPSRPIGSFIFLGPTGVGKTELCKA
LAEALFDSEENIVRMDMSEYMEKHAVARLIGAPPGYIGYDEGGQLTEAIRRKPYSVVLFDEIEKAHSDVF
NVLLQILDDGRITDSQGRTIDCKNTIIIMTSNLGSQLLLEGIEPDGEFKNGVQENVMNVLSGHFRPEFLN
RVDETVLFKPLLESDLKLIVDLQLEGLRARLGGQKMSLEVTENAKAFIAHASYDPVYGARPLRRYIQAHL
ETPLAKQIIGGDLREDQTVTIDVDADGLSFNVVS
 
Nucleotide Sequence: 2625 bp     [Download]
>gi|436839709|ref|NC_020055.1|:c2314314-2311690 Desulfovibrio hydrothermalis AM13 = DSM 14728 chromosome, complete genome
ATGGATCCGAATAAATTCACAAAAAAAACTAACGATGCAATTGCTGCGGCCCAGTCTTTAGCCGTTAAAA
ACGGCCAGCAACAAATTGAAGTGGAACACCTTCTCCTTGCCCTCGTGGAACAGGAAAACGGCATTGTTTC
CAAAATTATTCAGAAAAGCGACATTGATCCTTCGGCATATAAATCTGCCGTACAAAAGGAAATCGGCAAG
CTGCCCAGTGTCAGCGGCCCCGGCGCGCAGCCCGGACAGGTTCTTGTTACCCAGCGTCTTAACCGTATTA
TTGTTGAAGCCGAAGCGGCTGCCCAGCGCATGCAGGACGAGTTTATCAGCGTGGAGCATCTGTTCCTTGC
CATCATGGATGAACACGGCTCTACTGGTGCAGGGCGCGTTAATAAGTCCTTCAACTTGACCAAAGACAAA
GTGCTGGAAGCCATGACCACAATCCGCGGCAACCAGCGGGTCACGACCGATAATCCGGAAGCAACCTATG
ATGCGCTTAAAAAATACGGACGTGATCTGGTAGAGGAAGCACGCAAAGGTAAACTTGATCCGGTAATCGG
ACGTGATTCTGAAATCCGCCGCGTCATCCGCATTCTGTCCCGCAGAACCAAAAACAACCCGATCCTTATC
GGCGAGGCAGGTGTTGGTAAAACAGCCATAATTGAAGGGCTGGCCCAGCGCATTGTCAAACGTGATGTGC
CCGAGGGGCTTAAAGATAAAACCGTATTTATGCTCGACATGGGCGCGCTCATCGCCGGCGCCAAATATCG
TGGTGAATTTGAAGAACGACTCAAAGCCGTACTTAAAGAAGTTCAGGAATCCGATGGACAGATTATCATT
TTTATTGATGAAATCCATACTATCGTAGGTGCAGGAAAATCCGATGGTGCAATGGATGCCGGTAACCTGC
TCAAACCCATGCTGGCTCGCGGAGAGCTGCACTGCATAGGCGCGACAACAACTGATGAGTACCGCAAGTA
TATTGAAAAAGATCCGGCTCTCGAAAGAAGGTTCCAGACCATTATGGTTAAAGAACCCACTGCCGAAGAC
ACAATTTCTATCCTGCGCGGACTGCGTGAAAGATTTGAAGTGCACCACGGCGTGCGAATCAGCGATGCGG
CTTTAGTTGAAGCTGCGACCCTTTCACAGCGTTACATCACTGACCGTCAGCTGCCTGATAAAGCGATTGA
CCTCATTGATGAAGCTGCGGCCATGATCAGAACCGAGATTGACTCCCAGCCTTATGAGCTGGATAAGATC
AACCGTCAGATTTTGCAGACTGAAATTGAGCGTGAAGCACTCAGACGCGAAGAGGATCAAGCTTCGCGTG
AACGACTTTCCAAACTGGAAGACTCGCTCACCGAGATGAAGATTAAACAGTCTGAACTTGTTGAACAATG
GGAAAAAGAAAAGGCATCAATCGACACTGTCCGAAACCTCAAAGCCCAGATAGAACAGACAAAACTTCAA
ATCGAAGAAGCCGAAAGAAGTCTCGATTACAACCGCGCTGCGGAACTTAAATATTCAACCCTGCTGGGAC
TCGAAAAACGACTTGAAGAAATTCAGGTCGACATTGAAGGCGGTGAAGATAAAGCCTCTTCAAATGGAAG
CCGTTTACTTAAAGAATTTGTCGGGCCTGACGACATAGCCGGAATTATTTCGCGCTGGACCGGAATTCCG
GTCACCAGACTGGTTGAAGGCGAGCGTGAAAAACTGCTCCGTTTAGAAGATATCCTGCATGGAAGGGTTA
TCGGACAGGATGAGGCTGTGCGTGCTGTATCCGAAGCAGTACTGCGCGCCCGTGCAGGCCTTAAAGATCC
TTCAAGACCCATCGGTTCGTTCATCTTCCTCGGCCCGACCGGAGTAGGTAAAACGGAACTATGCAAGGCT
CTTGCAGAGGCTCTATTCGACAGCGAAGAAAATATCGTACGTATGGATATGTCCGAATACATGGAAAAAC
ATGCGGTAGCACGGTTGATCGGAGCGCCTCCGGGCTACATCGGCTACGATGAAGGCGGTCAACTGACCGA
GGCCATCCGCCGCAAACCTTACTCTGTTGTGCTCTTTGATGAAATAGAAAAAGCACACAGTGATGTCTTT
AACGTGCTGCTGCAAATCCTTGATGACGGACGTATCACGGATAGTCAGGGGCGCACTATAGATTGTAAAA
ATACTATCATTATCATGACCTCCAACCTCGGTTCACAACTGCTGCTGGAAGGAATTGAGCCTGATGGTGA
ATTCAAAAACGGTGTTCAGGAAAATGTAATGAACGTCCTTAGCGGACACTTCAGACCGGAATTCCTCAAC
CGCGTTGATGAAACAGTGCTGTTCAAGCCGCTGCTTGAGTCTGACCTCAAATTAATTGTTGATCTCCAGC
TTGAAGGACTGCGCGCACGTCTTGGCGGACAGAAAATGTCCTTGGAAGTAACAGAGAATGCTAAAGCTTT
CATAGCACATGCATCCTACGACCCAGTCTATGGAGCCAGACCGCTGCGCCGTTATATACAGGCGCACCTT
GAAACTCCGCTCGCAAAACAGATTATCGGCGGTGACCTCAGAGAAGATCAGACCGTGACCATTGATGTAG
ACGCGGACGGACTCAGCTTTAATGTTGTAAGTTAA