SecReT6
Protein ID: 440230366
SecReT6 ID723
T6SS typei2
Gene symbol-
Locus tagD781_1676
StrainSerratia marcescens FGI94
Repliconchromosome [GenBank: NC_020064] [Browse all T6SS(s) in this replicon]
Location [Strand]1764726..1765223 [+]
Producttype VI secretion protein, VC_A0107 family
NoteTssB
UniProt IDL0MDI7
KEGG IDsmaf:D781_1676
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.50E-55, Aligned region: 6..158
Protein Sequence: 165 a.a.     [Download]
>gi|440230366|ref|YP_007344159.1| type VI secretion protein, VC_A0107 family [Serratia marcescens FGI94]
MSNSYQSEIPKARVNIKLDLHTGGAQKKVELPLKLMVVGDYSNGSEQRPLSEREKINVNKNNFDSVLAEF
SPSVNLAVENTLAGDGSEENVSLTFREMNDFTPEQVARQIPQLKAMLAMRNLLRDLKANLLDNQTFRKEL
EKILLDPALSAELRDELSALAPAQP
 
Nucleotide Sequence: 498 bp     [Download]
>gi|440228796|ref|NC_020064.1|:1764726-1765223 Serratia marcescens FGI94, complete genome
ATGTCTAACTCATACCAGTCCGAGATCCCCAAGGCCCGCGTCAATATCAAGCTGGACCTGCATACCGGCG
GCGCCCAGAAAAAAGTCGAACTGCCCCTCAAGCTGATGGTGGTGGGGGATTACAGCAACGGCAGTGAACA
ACGCCCGCTGTCCGAGCGCGAGAAGATCAACGTTAACAAAAACAATTTTGACAGCGTACTGGCCGAATTC
TCTCCGTCGGTCAACCTGGCGGTGGAAAACACTCTGGCCGGCGACGGCAGCGAGGAAAACGTCAGCCTGA
CGTTCCGCGAGATGAACGATTTCACCCCGGAACAGGTTGCCCGCCAGATCCCGCAGCTGAAAGCCATGCT
GGCCATGCGCAACCTGCTGCGCGACCTGAAGGCCAACCTGCTGGACAACCAGACGTTCCGTAAAGAGCTG
GAGAAAATTCTGCTGGATCCCGCCCTGAGCGCTGAACTGCGCGATGAACTGTCCGCCCTGGCGCCGGCGC
AGCCGTAA