SecReT6
Protein ID: 440230367
SecReT6 ID723
T6SS typei2
Gene symbol-
Locus tagD781_1677
StrainSerratia marcescens FGI94
Repliconchromosome [GenBank: NC_020064] [Browse all T6SS(s) in this replicon]
Location [Strand]1765257..1766804 [+]
Producttype VI secretion protein, EvpB/VC_A0108 family
NoteTssC
UniProt IDL0MGU8
KEGG IDsmaf:D781_1677
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 5.30E-174, Aligned region: 90..511
Protein Sequence: 515 a.a.     [Download]
>gi|440230367|ref|YP_007344160.1| type VI secretion protein, EvpB/VC_A0108 family [Serratia marcescens FGI94]
MLMSVKNENAAGGESVVLECPQAGGVYASLFEKINLNPVASLSALDSWQDNQTMSDATADERVTAAMQIF
LERLKQSGDKVEKLDKTLLDHHIAELDHQISRQLDAVMHHEDFQRVESLWRGMKSLVDKTDFRQNVKIEL
LDLSKDDLRQDFEDAPEIVQSGLYLQTYVAEYDTPGCEPIGALISAYEFDASAQDIALLRNISKVSAAAH
MPFIGSAGPKFFLKDNMEDVAAIKDIGNYFDRAEYIKWKAFRETDDARYIGLVMPRVLGRLPYGPDTVPV
RSFNYVEEVKGPDHDKYLWTNASFAFAANMVRSFINNGWCVQIRGPQAGGAVQGLPIHLYDLGTGNQVKI
PSEVMIPETREFEFANLGFIPLSYYKNRDYACFFSANSAQKPALYDTADATANSRINARLPYIFLLSRIA
HYLKLIQRENIGTTKDRRLLELELNTWVRSLVTEMTDPGDELQASHPLRDARVAVEDIEDNPGFFRVKLY
AVPHFQVEGMDVNLSLVSQMPKAKA
 
Nucleotide Sequence: 1548 bp     [Download]
>gi|440228796|ref|NC_020064.1|:1765257-1766804 Serratia marcescens FGI94, complete genome
ATGCTGATGTCTGTAAAAAATGAGAATGCCGCCGGCGGCGAGAGCGTGGTGCTGGAGTGTCCGCAGGCGG
GCGGTGTGTATGCTTCCCTGTTTGAAAAAATCAACCTGAACCCGGTGGCGTCGCTGAGCGCGCTGGACAG
CTGGCAGGATAACCAGACGATGTCCGACGCCACGGCGGACGAACGCGTCACCGCCGCGATGCAGATCTTC
CTGGAGCGTCTGAAGCAGTCGGGCGACAAGGTGGAAAAACTCGACAAGACCCTGCTGGATCACCACATTG
CCGAACTGGACCATCAGATCAGCCGCCAGTTGGACGCGGTGATGCACCACGAGGATTTCCAACGCGTTGA
ATCCCTGTGGCGCGGCATGAAGTCGCTGGTGGACAAAACCGATTTCCGTCAGAACGTCAAAATCGAGCTG
CTGGATCTGTCGAAGGACGACCTGCGGCAGGATTTTGAGGACGCGCCGGAAATCGTGCAAAGCGGCCTCT
ACCTGCAGACCTACGTTGCCGAATACGACACCCCGGGCTGCGAGCCGATCGGCGCGCTGATCTCCGCCTA
TGAGTTCGACGCCTCCGCGCAGGATATCGCGCTGCTGCGCAATATTTCCAAGGTGTCCGCCGCGGCGCAC
ATGCCGTTTATCGGCTCCGCCGGGCCGAAGTTCTTCCTGAAAGACAACATGGAAGACGTCGCCGCCATTA
AGGATATCGGCAATTACTTTGACCGCGCCGAATACATTAAATGGAAAGCCTTCCGCGAAACTGATGACGC
GCGCTATATCGGCCTGGTGATGCCGCGCGTGCTGGGCCGCTTGCCGTATGGCCCGGACACCGTGCCGGTG
CGCAGCTTTAACTATGTGGAAGAGGTCAAAGGCCCGGACCACGATAAATACCTGTGGACCAACGCCTCCT
TCGCGTTCGCCGCCAATATGGTGCGCAGCTTTATCAACAACGGCTGGTGCGTGCAGATCCGCGGCCCGCA
GGCGGGCGGCGCGGTGCAGGGCCTGCCGATCCATCTCTACGATCTCGGCACCGGCAACCAGGTGAAAATC
CCGTCGGAAGTGATGATCCCGGAAACCCGTGAGTTTGAGTTCGCCAACCTGGGCTTTATCCCGCTGTCGT
ACTACAAAAACCGCGACTATGCGTGCTTCTTCTCCGCCAACTCCGCCCAGAAGCCGGCGCTGTACGACAC
CGCGGACGCAACCGCCAACAGCCGCATCAACGCGCGTCTGCCGTACATCTTCCTGCTGTCGCGCATCGCG
CACTACCTGAAGCTGATCCAGCGTGAAAACATCGGCACCACCAAGGATCGCCGCCTGCTGGAGCTGGAGC
TGAACACCTGGGTGCGCAGCCTGGTGACCGAAATGACCGATCCGGGCGACGAGCTGCAGGCCTCGCACCC
GCTGCGCGACGCCAGGGTGGCGGTGGAAGATATCGAAGACAACCCGGGCTTCTTCCGCGTGAAGTTGTAT
GCGGTGCCGCACTTCCAGGTGGAAGGGATGGACGTCAACCTGTCGCTGGTATCCCAGATGCCGAAGGCGA
AAGCATAA