SecReT6
Protein ID: 440230368
SecReT6 ID723
T6SS typei2
Gene symbol-
Locus tagD781_1678
StrainSerratia marcescens FGI94
Repliconchromosome [GenBank: NC_020064] [Browse all T6SS(s) in this replicon]
Location [Strand]1766817..1768157 [+]
Producttype VI secretion protein, VC_A0114 family
NoteTssK
UniProt IDL0MH27
KEGG IDsmaf:D781_1678
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.60E-135, Aligned region: 18..443
Protein Sequence: 446 a.a.     [Download]
>gi|440230368|ref|YP_007344161.1| type VI secretion protein, VC_A0114 family [Serratia marcescens FGI94]
MKIEQPLWGRGIMISPQHFQQQAAHAAWSAESIAQMGLNHPWGVFEAAFDADMLKLGRLQAQHLHVRFQD
GTLVDTAHADPLPPALTLDGERQDVVVVLALPLLRANGGNCLKPDETAERPVRYRQRWRDVRNQYGDDDR
QIAVMQAELTLRFAHQNNGDYLTCPVARLLQDSQGNWVIDEAYLPPLLAMRGSRWLMTQLELLMTQLRAR
LTRLMAMRRESNERMADFAVADVSLFWLLNALNSAEPVLGQFQHFPQSAPERLYPELARLAGSLLTFSLD
HQLSAIPAWRHEQLNEVFPPLFALLGELLEASLPSRVMAIALTHDKRLRQWQARLQEPRLHEGADYYLSV
RSPLPAAQLQEQFPRQCKVGSPDYVTSLVNSSRQGIPLKPLSHVPAAIPLRLENQYFSLDLAHPAAQEML
ASGSCMFYVPGTLGEPELELFAVLRT
 
Nucleotide Sequence: 1341 bp     [Download]
>gi|440228796|ref|NC_020064.1|:1766817-1768157 Serratia marcescens FGI94, complete genome
GTGAAGATTGAACAGCCGCTATGGGGGCGGGGGATCATGATCTCGCCCCAGCATTTTCAACAGCAGGCGG
CGCATGCGGCCTGGAGCGCTGAAAGTATTGCTCAGATGGGGCTGAATCACCCATGGGGGGTGTTCGAGGC
CGCATTCGACGCGGATATGCTGAAGCTGGGCCGCCTGCAGGCCCAGCATTTACACGTACGTTTTCAGGAC
GGCACGCTGGTTGACACGGCGCATGCCGATCCGCTGCCGCCGGCGCTTACGCTTGACGGCGAACGTCAGG
ACGTGGTGGTGGTGCTGGCTCTGCCGCTGCTGCGCGCCAATGGCGGCAATTGCCTGAAGCCCGATGAGAC
GGCGGAGCGCCCGGTGCGCTACCGCCAGCGCTGGCGTGACGTGCGTAACCAATATGGTGATGACGATCGC
CAGATCGCCGTGATGCAGGCGGAGCTTACTCTGCGCTTCGCCCATCAGAACAACGGCGATTACCTGACCT
GCCCGGTGGCGCGCCTGTTGCAGGATTCGCAGGGAAACTGGGTAATTGACGAAGCGTATCTGCCGCCGCT
GTTAGCGATGCGGGGCAGCCGCTGGTTGATGACCCAACTGGAACTGCTGATGACGCAATTACGTGCCCGT
CTGACCCGCCTGATGGCCATGCGTCGGGAGAGTAACGAGCGCATGGCGGATTTTGCCGTGGCGGACGTCT
CGCTGTTCTGGCTGCTCAATGCCCTGAACAGCGCGGAACCGGTGTTGGGGCAGTTTCAGCATTTCCCACA
GAGCGCGCCGGAGCGACTTTATCCGGAGCTGGCGCGCCTGGCCGGCAGCCTGCTGACTTTTTCTCTGGAT
CATCAGCTCAGCGCCATTCCTGCCTGGCGGCATGAACAGCTGAATGAGGTGTTTCCGCCGCTGTTCGCGC
TGCTCGGCGAGCTGCTGGAAGCCAGCCTGCCATCGCGGGTGATGGCGATTGCGCTGACGCACGACAAACG
GCTGCGCCAGTGGCAGGCGCGCTTGCAGGAGCCGCGTCTGCATGAAGGGGCGGATTACTACCTTTCCGTG
CGTTCGCCACTGCCGGCGGCGCAGCTGCAGGAGCAGTTTCCGCGGCAGTGCAAAGTGGGCAGCCCCGATT
ATGTGACCAGCCTGGTAAATAGCTCCCGTCAGGGGATCCCGCTGAAACCGCTGAGTCATGTGCCGGCGGC
TATCCCGTTGCGGCTGGAGAACCAGTACTTCTCGCTCGATCTGGCTCATCCCGCAGCGCAGGAGATGCTG
GCCAGCGGCAGCTGTATGTTTTACGTCCCGGGCACGCTGGGCGAGCCTGAGCTTGAACTGTTTGCGGTGC
TGAGAACATGA