SecReT6
Protein ID: 440230369
SecReT6 ID723
T6SS typei2
Gene symbol-
Locus tagD781_1679
StrainSerratia marcescens FGI94
Repliconchromosome [GenBank: NC_020064] [Browse all T6SS(s) in this replicon]
Location [Strand]1768154..1768828 [+]
Producttype IV / VI secretion system protein, DotU family
NoteTssL
UniProt IDL0MFB8
KEGG IDsmaf:D781_1679
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 9.60E-41, Aligned region: 9..211
Protein Sequence: 224 a.a.     [Download]
>gi|440230369|ref|YP_007344162.1| type IV / VI secretion system protein, DotU family [Serratia marcescens FGI94]
MSEKQECDIDALLQNSWLQVISLRHGPAFNDGDGRVLWEHCVADVEQVQQALREAGCDEASRRHILYAQC
ALIDEAVKGRGVQDDACVQWYDMPLQGHFLGTIDAGDTLCDRMRDVLREPAPDSAVLTCFHRVMLLGFLG
GYRSLNDPEREKLLQALHDRVPPFGYPQTAPVLAGVKGGRRMSDWFAAWPVRIGCAQLALAVLWWGLDHW
LDTLLTTLLPGAVQ
 
Nucleotide Sequence: 675 bp     [Download]
>gi|440228796|ref|NC_020064.1|:1768154-1768828 Serratia marcescens FGI94, complete genome
ATGAGTGAAAAACAAGAGTGCGACATCGATGCGCTGTTGCAGAACAGCTGGCTGCAGGTCATCAGCCTGC
GCCATGGACCGGCGTTTAACGATGGGGACGGCCGCGTGCTGTGGGAGCATTGCGTGGCGGACGTGGAGCA
GGTGCAGCAGGCGTTGCGTGAGGCCGGCTGCGACGAGGCCAGCCGCCGGCATATTCTCTATGCCCAGTGC
GCGTTGATTGATGAGGCAGTTAAAGGGCGCGGCGTGCAGGATGATGCGTGCGTACAGTGGTATGACATGC
CGCTGCAGGGGCATTTTCTCGGCACCATCGATGCCGGCGACACGCTGTGCGACCGGATGCGCGATGTGCT
GCGTGAGCCAGCGCCTGACAGCGCGGTGCTGACCTGTTTCCACCGGGTGATGCTGCTGGGGTTCCTTGGC
GGATACCGTTCGCTGAACGATCCCGAGCGGGAGAAGCTGCTGCAGGCGCTGCACGATCGTGTCCCGCCGT
TTGGCTATCCGCAGACGGCGCCGGTGTTGGCCGGGGTTAAAGGCGGCCGCAGGATGAGCGACTGGTTCGC
CGCCTGGCCGGTGCGCATCGGCTGCGCGCAGCTGGCGCTGGCCGTACTGTGGTGGGGGCTTGACCACTGG
CTGGATACGCTGCTGACCACGCTGCTGCCGGGAGCGGTGCAATGA