SecReT6
Protein ID: 440230371
SecReT6 ID723
T6SS typei2
Gene symbol-
Locus tagD781_1681
StrainSerratia marcescens FGI94
Repliconchromosome [GenBank: NC_020064] [Browse all T6SS(s) in this replicon]
Location [Strand]1770539..1771030 [+]
Producttype VI secretion system effector, Hcp1 family
NoteTssD
UniProt IDL0MDJ1
KEGG IDsmaf:D781_1681
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.30E-36, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|440230371|ref|YP_007344164.1| type VI secretion system effector, Hcp1 family [Serratia marcescens FGI94]
MAIPVYLWLKDDGGADIKGSVDVQDRDGSIEVVAQEHNLYIPTDNNTGKLTGTRIHTPFLFTKEIDASSP
YLYKAVTTGQTLKSAEFKWYRINDAGQEVEYFNTKLENVKVVKVNPLMHDIKDPSFEKHNHLEQIELRYE
KITWTYKDGNIIHSDSWNERATA
 
Nucleotide Sequence: 492 bp     [Download]
>gi|440228796|ref|NC_020064.1|:1770539-1771030 Serratia marcescens FGI94, complete genome
ATGGCAATTCCTGTTTATCTTTGGCTGAAAGACGACGGCGGCGCGGACATCAAAGGGTCGGTGGACGTTC
AAGATCGCGACGGCAGCATCGAAGTGGTGGCGCAGGAACATAACCTGTACATCCCGACCGATAACAACAC
CGGCAAGCTGACCGGCACCCGTATCCATACGCCGTTCCTGTTTACCAAGGAAATCGATGCCTCCAGCCCG
TACCTGTACAAGGCGGTCACCACCGGCCAGACCCTGAAGTCGGCGGAGTTCAAATGGTACCGCATTAACG
ATGCCGGTCAGGAAGTGGAGTACTTCAACACCAAACTGGAGAACGTGAAGGTGGTGAAAGTGAATCCGCT
GATGCATGACATCAAGGATCCGTCGTTTGAAAAGCATAACCACCTCGAGCAGATCGAGCTGCGTTACGAA
AAAATCACCTGGACCTACAAAGACGGCAACATCATTCATTCCGACTCTTGGAACGAACGCGCTACCGCGT
AA