SecReT6
Protein ID: 440230372
SecReT6 ID723
T6SS typei2
Gene symbol-
Locus tagD781_1682
StrainSerratia marcescens FGI94
Repliconchromosome [GenBank: NC_020064] [Browse all T6SS(s) in this replicon]
Location [Strand]1771304..1773943 [+]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDL0MGV0
KEGG IDsmaf:D781_1682
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 6.40E-41, Aligned region: 233..252
AAA_2 [PF07724], Evalue: 6.40E-41, Aligned region: 607..772
AAA [PF00004], Evalue: 3.60E-19, Aligned region: 235..347
AAA [PF00004], Evalue: 3.60E-19, Aligned region: 612..734
AAA [PF00004], Evalue: 3.60E-19, Aligned region: 760..777
AAA_5 [PF07728], Evalue: 2.20E-14, Aligned region: 81..99
AAA_5 [PF07728], Evalue: 2.20E-14, Aligned region: 235..259
AAA_5 [PF07728], Evalue: 2.20E-14, Aligned region: 332..365
AAA_5 [PF07728], Evalue: 2.20E-14, Aligned region: 611..731
ClpB_D2-small [PF10431], Evalue: 3.30E-13, Aligned region: 376..403
ClpB_D2-small [PF10431], Evalue: 3.30E-13, Aligned region: 778..852
AAA_16 [PF13191], Evalue: 5.80E-13, Aligned region: 140..156
AAA_16 [PF13191], Evalue: 5.80E-13, Aligned region: 212..257
AAA_16 [PF13191], Evalue: 5.80E-13, Aligned region: 280..313
AAA_16 [PF13191], Evalue: 5.80E-13, Aligned region: 592..647
AAA_16 [PF13191], Evalue: 5.80E-13, Aligned region: 675..705
AAA_16 [PF13191], Evalue: 5.80E-13, Aligned region: 750..862
AAA_22 [PF13401], Evalue: 2.10E-10, Aligned region: 234..320
AAA_22 [PF13401], Evalue: 2.10E-10, Aligned region: 608..652
AAA_22 [PF13401], Evalue: 2.10E-10, Aligned region: 734..763
AAA_19 [PF13245], Evalue: 7.20E-08, Aligned region: 232..263
AAA_19 [PF13245], Evalue: 7.20E-08, Aligned region: 607..639
AAA_25 [PF13481], Evalue: 8.80E-08, Aligned region: 235..259
AAA_25 [PF13481], Evalue: 8.80E-08, Aligned region: 288..323
AAA_25 [PF13481], Evalue: 8.80E-08, Aligned region: 483..527
AAA_25 [PF13481], Evalue: 8.80E-08, Aligned region: 607..640
AAA_25 [PF13481], Evalue: 8.80E-08, Aligned region: 778..815
NACHT [PF05729], Evalue: 2.40E-06, Aligned region: 235..315
NACHT [PF05729], Evalue: 2.40E-06, Aligned region: 611..636
NACHT [PF05729], Evalue: 2.40E-06, Aligned region: 743..760
IstB_IS21 [PF01695], Evalue: 1.10E-05, Aligned region: 229..295
IstB_IS21 [PF01695], Evalue: 1.10E-05, Aligned region: 611..629
Arch_ATPase [PF01637], Evalue: 1.40E-05, Aligned region: 213..250
Arch_ATPase [PF01637], Evalue: 1.40E-05, Aligned region: 287..374
Arch_ATPase [PF01637], Evalue: 1.40E-05, Aligned region: 604..624
Arch_ATPase [PF01637], Evalue: 1.40E-05, Aligned region: 681..693
Zeta_toxin [PF06414], Evalue: 2.30E-05, Aligned region: 229..259
Zeta_toxin [PF06414], Evalue: 2.30E-05, Aligned region: 598..651
Sigma54_activat [PF00158], Evalue: 3.60E-05, Aligned region: 219..249
Sigma54_activat [PF00158], Evalue: 3.60E-05, Aligned region: 610..728
AAA_14 [PF13173], Evalue: 7.40E-05, Aligned region: 235..325
AAA_14 [PF13173], Evalue: 7.40E-05, Aligned region: 609..693
AAA_17 [PF13207], Evalue: 9.80E-05, Aligned region: 235..300
AAA_17 [PF13207], Evalue: 9.80E-05, Aligned region: 610..646
Clp_N [PF02861], Evalue: 0.00034, Aligned region: 22..56
Clp_N [PF02861], Evalue: 0.00034, Aligned region: 101..122
AAA_29 [PF13555], Evalue: 0.0028, Aligned region: 229..251
AAA_29 [PF13555], Evalue: 0.0028, Aligned region: 607..622
RNA_helicase [PF00910], Evalue: 0.0042, Aligned region: 236..257
RNA_helicase [PF00910], Evalue: 0.0042, Aligned region: 612..632
RNA_helicase [PF00910], Evalue: 0.0042, Aligned region: 709..730
SRP54 [PF00448], Evalue: 0.0048, Aligned region: 235..257
SRP54 [PF00448], Evalue: 0.0048, Aligned region: 610..640
AAA_33 [PF13671], Evalue: 0.0097, Aligned region: 235..252
AAA_33 [PF13671], Evalue: 0.0097, Aligned region: 428..433
AAA_33 [PF13671], Evalue: 0.0097, Aligned region: 610..628
AAA_33 [PF13671], Evalue: 0.0097, Aligned region: 733..784
Protein Sequence: 879 a.a.     [Download]
>gi|440230372|ref|YP_007344165.1| type VI secretion ATPase, ClpV1 family [Serratia marcescens FGI94]
MENSAVLLRRLNPYCARALEGAASLCQTRAHAQILPEHWLLKLLEQGEGDLTVLARRYEWNMDEIWQALL
NWLDGLPRSVRGRPELADSLLTLLQEAWLLASLAGETQIRSVHLLTALVGKPALARCDGLWPLLTLGQSQ
LERLRPLLDAQSEERPEVQQEAGLAQTCAEVAEPAADAELKAGELSPALQGALDKFTLDVTAKARAGAID
PVFGRDTEIRQMVDILSRRRKNNPILVGEPGVGKTALVEGLALRIAEGNVPASLQPVTLRTLDLGLLQAG
AGVKGEFEQRLKNIIDAVQQSPTPVLLFIDEAHTIIGAGNQAGGADAANLLKPALARGELRTIAATTWSE
YKQYFERDAALERRFQMVKVDEPDDAIACLMLRGLKSRYAQHHGVHITDEAVRTAVTLSRRYLTGRQLPD
KAVDLLDTASARVRMSLDTVPEAIVHAQAAVTALALEEQALLADIAVGNPAEEGRLAAIAAQTAELNQRL
AQLEGQYRQEQELIGQLLACRTDGARQAEIATVQQALAALPLEQALLTADVDARSVANVIADWTGVPLSS
LMKDEQNELLSLETEIGRRVVGQDAALYAIAQRLRAAKTGLTSENGPQGVFLLVGPSGTGKTETALTLAD
CLYGGEKSLIAINLSEYQEPHTVSQLKGSPPGYVGYGQGGILTEAVRKRPYSVVLLDEVEKAHRDVMNLF
YQVFDRGFMRDGEGREIDFRNTVILMTSNLGSDHIMQLLDEQPQATEADLQELLRPLLRDHFQPALLARF
QTVIYRPLAAEAMRTIVQMKLEQVSRRLQRHYGLATQIGDGLYDALTAACLLPDTGARNVDSLLNQQLLP
VLSQQLLSQMAAKRKPQALTLDWHDEEGIVLAFDNNKGE
 
Nucleotide Sequence: 2640 bp     [Download]
>gi|440228796|ref|NC_020064.1|:1771304-1773943 Serratia marcescens FGI94, complete genome
ATGGAAAATTCAGCCGTCCTGTTACGCCGTCTTAATCCTTATTGCGCCCGCGCCCTGGAAGGGGCGGCGT
CGCTGTGTCAGACCCGCGCCCATGCGCAGATCCTGCCGGAGCACTGGCTGCTGAAGCTGCTGGAGCAGGG
CGAGGGAGATCTGACGGTACTGGCGCGGCGTTACGAATGGAATATGGATGAGATCTGGCAGGCGCTGCTG
AACTGGCTGGACGGCCTGCCGCGCTCGGTGCGTGGGCGGCCGGAACTGGCGGACAGCCTGCTGACGCTGT
TGCAGGAGGCCTGGCTGCTGGCCTCGCTGGCCGGCGAGACGCAGATCCGCAGCGTTCACCTGCTGACGGC
GCTGGTAGGCAAGCCCGCGCTGGCGCGCTGCGACGGCCTGTGGCCGCTGCTAACGCTGGGACAGAGCCAG
CTGGAGCGCCTGCGTCCGCTGCTGGATGCGCAGTCGGAAGAGCGTCCGGAGGTGCAGCAGGAGGCCGGGC
TGGCGCAGACTTGCGCCGAGGTGGCGGAGCCTGCGGCGGACGCCGAGCTAAAGGCGGGCGAACTCTCCCC
GGCGCTACAGGGTGCGCTGGATAAATTCACCCTCGACGTCACCGCCAAGGCGCGGGCCGGCGCGATCGAC
CCGGTGTTCGGCCGCGATACCGAGATCCGCCAGATGGTGGACATTCTCTCCCGCCGGCGTAAAAACAACC
CGATCCTGGTGGGCGAACCGGGCGTGGGGAAAACCGCGCTGGTGGAAGGGCTGGCGCTGCGCATTGCCGA
GGGCAACGTACCGGCCAGCCTGCAGCCGGTCACCCTGCGTACGCTGGATCTCGGGCTGCTGCAGGCCGGC
GCCGGCGTGAAGGGCGAGTTTGAACAGCGGCTGAAAAACATTATCGATGCGGTGCAGCAGTCGCCGACGC
CGGTGCTGCTGTTTATCGACGAGGCCCACACCATTATCGGCGCCGGTAATCAGGCCGGCGGCGCCGATGC
CGCCAACCTGCTGAAGCCGGCGCTGGCGCGCGGCGAACTGCGCACCATCGCCGCCACCACCTGGAGCGAA
TACAAACAGTACTTCGAGCGCGACGCGGCGCTGGAGCGTCGTTTCCAGATGGTGAAAGTGGACGAACCGG
ACGACGCCATCGCCTGCCTGATGCTGCGCGGCCTGAAATCCCGCTATGCGCAGCACCACGGCGTACATAT
CACCGATGAGGCGGTGCGCACCGCCGTCACGCTCTCCCGCCGCTATCTCACCGGCCGCCAGCTGCCGGAT
AAGGCGGTGGATCTGTTGGATACCGCCAGCGCGCGGGTGCGCATGAGCCTGGACACCGTGCCGGAAGCGA
TCGTCCACGCACAGGCCGCCGTTACCGCGCTGGCGCTGGAAGAGCAGGCGTTGCTGGCGGATATCGCCGT
CGGCAACCCGGCAGAAGAAGGACGGCTGGCGGCCATCGCCGCCCAGACCGCGGAACTGAACCAGCGTCTG
GCGCAGCTGGAAGGCCAGTACCGTCAGGAGCAGGAACTGATTGGTCAACTGCTGGCGTGCCGTACGGACG
GCGCGCGTCAGGCGGAGATCGCGACTGTCCAGCAGGCGCTGGCGGCGCTGCCCCTCGAGCAGGCGCTGCT
CACGGCGGACGTTGACGCCCGCAGCGTGGCCAACGTGATCGCCGACTGGACCGGGGTGCCGCTCTCTTCC
TTAATGAAGGACGAGCAGAACGAACTGCTGAGTCTGGAGACGGAAATCGGCCGGCGGGTGGTCGGGCAGG
ATGCGGCGCTGTACGCCATTGCCCAGCGGCTGCGCGCCGCCAAAACCGGCCTGACCAGCGAAAATGGGCC
GCAGGGCGTGTTCCTGCTGGTGGGACCGAGCGGCACCGGTAAAACCGAAACCGCACTCACGCTGGCCGAC
TGCCTGTACGGCGGTGAAAAATCGCTGATCGCCATCAACCTCTCCGAATATCAGGAACCGCACACCGTTT
CCCAACTGAAAGGCTCGCCGCCGGGCTACGTCGGCTACGGCCAGGGCGGTATTCTGACCGAGGCGGTGCG
CAAGCGGCCGTACAGCGTGGTGCTGCTGGATGAGGTGGAAAAGGCGCACCGCGACGTGATGAACCTGTTC
TATCAGGTGTTCGACCGCGGCTTTATGCGCGACGGCGAGGGACGCGAAATCGACTTCCGCAACACCGTGA
TCCTGATGACCTCCAACCTCGGCAGCGACCACATTATGCAGCTGCTGGACGAACAGCCGCAGGCCACGGA
GGCGGATCTGCAGGAGCTGCTGCGGCCGCTGCTGCGCGACCACTTCCAGCCGGCGCTGCTGGCCCGTTTC
CAGACGGTGATTTACCGGCCGCTGGCGGCGGAGGCGATGCGCACCATCGTGCAGATGAAGCTGGAGCAGG
TCAGCCGGCGGCTGCAGCGCCACTACGGTCTCGCCACCCAGATCGGCGACGGCCTGTACGACGCGCTGAC
CGCCGCCTGCCTGCTGCCGGATACCGGCGCGCGCAACGTCGACAGCCTGCTTAACCAGCAGCTGCTGCCG
GTGCTCAGCCAGCAGCTGTTAAGCCAGATGGCGGCGAAGCGGAAACCGCAGGCTCTGACCCTCGACTGGC
ATGACGAGGAAGGGATTGTGTTGGCGTTTGATAACAACAAGGGAGAGTGA