SecReT6
Protein ID: 440230373
SecReT6 ID723
T6SS typei2
Gene symbol-
Locus tagD781_1683
StrainSerratia marcescens FGI94
Repliconchromosome [GenBank: NC_020064] [Browse all T6SS(s) in this replicon]
Location [Strand]1773946..1776324 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDL0MH32
KEGG IDsmaf:D781_1683
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.50E-61, Aligned region: 33..345
DUF2345 [PF10106], Evalue: 4.30E-41, Aligned region: 609..760
T6SS_Vgr [PF13296], Evalue: 1.30E-34, Aligned region: 489..590
T6SS_Vgr [PF13296], Evalue: 1.30E-34, Aligned region: 634..675
Phage_base_V [PF04717], Evalue: 1.10E-17, Aligned region: 389..483
Protein Sequence: 792 a.a.     [Download]
>gi|440230373|ref|YP_007344166.1| Rhs element Vgr protein [Serratia marcescens FGI94]
MANPLAVIFSHSHHLLQVADCNALLDVLAFEGQEELSKPFSYRIEFTSADHGIHRQAMLMKAASLTLQAP
FNQGAAIKLQQPLRVIQGVVTGFERLGTTNDESRYALTLSPRLALLAHSRQNAIYQDMSAPQIVEKILRE
RHGMRGQDFLFSLTQDYPRREQVMQYGEDDLRFITRLLGELGIWFRFTADTRLNIDVVEFCDGRQGYGAG
LTLPSVPPSGQHDEGVESCWGLESRHQVVEKQVSLRDYNYRQALEAMDAQAEIGAGDGTTYGDAYHYADN
YLTAGSGDGRTPAAESGAFYARIRHERYLNRQTRLFGVSSSVALVPGEVIRVSGGAEVAEVFRRGVAIVR
TISTARRDKSLEIGFEAIPDDADYAYRPVAPLRPVMAGTLPARVTSTTENDSYGHIDRDGRYRVNMLFDR
AGWETGFESLWVRQSRPYAGETYGLHLPLLAGTEVAIGFEDGNPDRPYIAGVLHDSAHPDPVTIRNYKRN
VLRTPANNKIRLDDSRGQEHIKVSTEYGGKSQLNLGHLVDAEKQQRGEGFELRTDSWGAIRAQKGLFISA
DGQPKAQGEVLAMQPVISLLKGALHQVAEWGSITQIHRSHSPAVSGLKQLADSADKLKDPLLLMSAPKGL
GAMTPETMLLHSGNGLYMQSLGEVNLTSAQRLSANASQAVSLLAQSEGMRLVSAKGPLEMESHGDILSLT
SLKEITVQSTQGHLQLTAKNGITLGCGGAYIRLTPQGVVEIHGPGLISLKGQHDLQGPASETFPLPELPA
SVCKECLKKAQQLAQGFVPREA
 
Nucleotide Sequence: 2379 bp     [Download]
>gi|440228796|ref|NC_020064.1|:1773946-1776324 Serratia marcescens FGI94, complete genome
ATGGCAAATCCGCTTGCGGTGATTTTCAGCCACAGCCACCACCTGCTGCAGGTGGCGGACTGCAACGCGC
TGCTGGACGTGCTGGCCTTTGAGGGGCAGGAGGAACTAAGTAAACCGTTCAGCTACCGGATTGAATTTAC
CAGCGCCGATCACGGTATTCATCGGCAGGCGATGCTGATGAAGGCGGCGTCGCTGACGCTGCAGGCGCCG
TTCAATCAGGGCGCCGCGATTAAACTGCAGCAGCCGCTGCGGGTGATCCAGGGCGTAGTCACCGGCTTCG
AGCGTCTGGGAACGACCAACGATGAGAGTCGCTACGCGCTGACCCTGTCGCCGCGGCTGGCGCTGCTGGC
CCACAGCCGGCAGAACGCCATCTATCAGGATATGTCTGCGCCGCAGATCGTGGAGAAAATCCTGCGCGAG
CGCCACGGCATGCGCGGTCAGGATTTCCTGTTCTCGCTGACGCAGGACTACCCGCGGCGCGAGCAGGTGA
TGCAGTACGGTGAGGACGACCTGCGTTTTATCACCCGGCTGCTGGGGGAGCTGGGCATCTGGTTCCGCTT
TACCGCCGACACCCGGCTGAATATCGACGTGGTGGAGTTTTGCGACGGTCGTCAGGGCTACGGCGCGGGG
CTGACGCTGCCGTCGGTGCCGCCCTCCGGCCAGCATGACGAGGGCGTAGAGTCGTGCTGGGGGCTGGAGA
GCCGCCATCAGGTGGTGGAAAAACAGGTCAGCCTGCGGGATTACAACTACCGGCAGGCGCTGGAGGCGAT
GGATGCGCAGGCGGAGATTGGCGCCGGCGACGGCACCACCTATGGCGATGCCTATCATTATGCGGATAAC
TACCTGACGGCCGGCAGCGGCGACGGGCGTACCCCGGCCGCAGAGAGCGGCGCGTTTTATGCCCGCATCC
GCCATGAACGCTACCTGAACCGTCAGACCCGGCTGTTCGGCGTCAGCAGCAGCGTCGCGCTGGTGCCGGG
CGAAGTCATCAGGGTGAGCGGCGGCGCGGAGGTGGCGGAGGTATTCCGCCGGGGCGTGGCGATCGTCCGG
ACGATCAGCACGGCGCGGCGCGACAAGAGCCTGGAAATCGGCTTTGAGGCGATCCCGGACGATGCGGACT
ATGCCTACCGACCGGTCGCGCCGCTGCGGCCGGTGATGGCCGGCACGCTGCCGGCGCGGGTCACCAGCAC
CACCGAGAACGACAGCTACGGGCATATCGACCGCGACGGCCGCTACCGGGTCAACATGCTGTTTGACCGG
GCGGGTTGGGAAACCGGCTTTGAAAGCCTGTGGGTGCGCCAGTCGCGGCCCTACGCCGGGGAGACCTACG
GCCTGCACCTGCCGCTGCTGGCGGGCACCGAGGTGGCGATCGGCTTTGAGGACGGCAACCCGGACCGGCC
GTACATTGCCGGCGTGCTGCATGATTCGGCGCACCCGGACCCGGTCACCATCCGCAACTACAAACGCAAC
GTGCTGCGCACGCCGGCGAACAACAAAATCCGCCTGGACGACAGCCGGGGCCAGGAGCATATCAAGGTCT
CCACCGAGTACGGCGGCAAGAGCCAGCTGAACCTCGGTCATTTGGTCGATGCGGAAAAGCAGCAGCGCGG
CGAGGGCTTTGAGCTGCGCACCGACAGCTGGGGCGCCATCCGGGCGCAGAAGGGGCTGTTCATCAGCGCC
GACGGCCAGCCAAAGGCGCAGGGCGAAGTGCTGGCGATGCAGCCTGTGATTAGCCTGCTGAAAGGCGCGC
TGCATCAGGTCGCCGAGTGGGGCAGTATTACGCAGATCCACCGTAGCCACAGCCCTGCGGTCAGCGGACT
GAAACAGTTGGCGGACAGCGCAGACAAACTGAAAGATCCGTTACTGCTAATGAGCGCGCCGAAAGGGCTG
GGCGCCATGACCCCTGAAACGATGTTGCTGCACAGCGGTAACGGTTTGTATATGCAGAGCCTTGGCGAAG
TAAACCTCACCAGCGCACAGCGCCTGTCGGCAAACGCCAGTCAGGCCGTCTCGCTGCTGGCGCAGAGCGA
GGGTATGCGGCTGGTATCCGCCAAGGGCCCGTTGGAGATGGAGTCACATGGCGATATCTTATCGCTGACC
TCCCTGAAAGAGATTACCGTCCAGTCTACGCAGGGACACCTGCAATTGACGGCTAAAAATGGCATCACTC
TGGGCTGCGGCGGGGCTTATATTCGCCTCACGCCGCAGGGCGTGGTGGAAATTCACGGTCCGGGATTAAT
CAGCCTGAAAGGTCAGCACGATCTGCAGGGGCCAGCCAGTGAGACGTTTCCCCTGCCTGAGCTCCCGGCA
TCGGTGTGTAAAGAGTGTCTGAAAAAAGCGCAGCAGCTGGCGCAGGGCTTCGTGCCAAGGGAGGCATAA