SecReT6
Protein ID: 440230382
SecReT6 ID723
T6SS typei2
Gene symbol-
Locus tagD781_1692
StrainSerratia marcescens FGI94
Repliconchromosome [GenBank: NC_020064] [Browse all T6SS(s) in this replicon]
Location [Strand]1787072..1788676 [+]
Producttype VI secretion-associated protein, VC_A0119 family
NoteTssA
UniProt IDL0MGV7
KEGG IDsmaf:D781_1692
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.20E-20, Aligned region: 71..130
ImpA-rel_N [PF06812], Evalue: 1.20E-20, Aligned region: 304..317
Protein Sequence: 534 a.a.     [Download]
>gi|440230382|ref|YP_007344175.1| type VI secretion-associated protein, VC_A0119 family [Serratia marcescens FGI94]
MDEIMGVLQNILHACGVDEKTLLVQARTRCANWQSWLLPLSAENPTGEDPGYDDDFQRIREEVNQLSGID
TGLICALAEKLLTQRCKDIRVVTFYIWARLHQDGEAGLAQGLELLAAMLQQFAGGLHPQRERSRKSALEW
LGSGRVLDSLSLYPEVDPAMMRRVTGALLLVEQAMEAWDEANRPRLSALYQALETRLAQNGGAGTLVPQT
SREENAEPASAGAALPTAHAVNSGRDLLDQAKMLAKYLRDCEGGWLAGHHLMKSVRWDTLTALPPLDASG
RTRLAAPKPDHRAHLKRLYLQQSWAELLELADNLFAQGVNHLWLDVQWYIWQALQKTDADAVRADIIGRD
LRGLLTRLPGLESLAFNDGTPFADEVTLGWIGQQVLDDPAAWREEPLSVAVADDDLLTLEPEVLARADSD
GIEAALGWLQTRPGVTSPRDRWLQRLLMARVTEQYGKNEMALHLLGELDNSAQALTLSQWSPEMAFEVKA
RRLKLLRQKAARSEADKVRQQPEMDALLAGLIAIDPARAAVLCG
 
Nucleotide Sequence: 1605 bp     [Download]
>gi|440228796|ref|NC_020064.1|:1787072-1788676 Serratia marcescens FGI94, complete genome
ATGGATGAAATAATGGGTGTATTACAGAACATACTCCACGCCTGTGGGGTAGATGAAAAAACCTTACTGG
TCCAGGCCAGGACACGCTGCGCGAACTGGCAAAGCTGGCTGCTGCCGCTCTCTGCCGAAAATCCTACGGG
GGAAGATCCGGGCTACGACGACGATTTTCAACGTATCCGCGAGGAGGTCAATCAGCTGTCCGGCATCGAT
ACCGGGCTGATTTGCGCTCTGGCGGAAAAGCTGCTGACGCAGCGCTGCAAGGATATTCGCGTCGTAACCT
TCTACATCTGGGCGCGTCTGCATCAGGATGGCGAGGCCGGGCTGGCGCAGGGGCTGGAGCTGCTGGCCGC
TATGCTGCAGCAGTTTGCTGGCGGGCTGCACCCGCAGCGTGAGCGTAGCCGCAAAAGCGCGCTGGAGTGG
CTGGGCAGCGGCCGGGTGCTCGACAGTCTGTCCCTGTACCCGGAGGTCGACCCGGCCATGATGCGGCGCG
TAACGGGGGCGCTGCTGCTGGTCGAGCAAGCCATGGAAGCGTGGGATGAGGCGAACCGCCCCCGGCTGTC
GGCGCTGTATCAGGCGTTGGAAACGCGGCTGGCGCAAAATGGCGGCGCCGGCACGCTGGTGCCGCAGACC
AGCCGTGAAGAGAACGCGGAGCCGGCGTCCGCCGGCGCGGCGCTGCCGACGGCGCATGCCGTGAATTCAG
GGCGCGATCTGCTTGATCAGGCAAAAATGCTGGCGAAGTATCTGCGCGATTGCGAAGGGGGCTGGCTGGC
CGGTCATCACCTGATGAAAAGCGTCCGCTGGGATACCTTAACGGCGCTGCCGCCGCTGGACGCCAGCGGT
CGCACGCGCCTTGCCGCGCCCAAGCCGGATCACCGCGCGCACCTCAAGCGGCTGTACCTTCAGCAGAGCT
GGGCAGAGCTGCTGGAACTGGCGGACAACCTTTTTGCTCAGGGGGTTAACCATCTGTGGCTGGATGTACA
GTGGTACATCTGGCAGGCGCTGCAGAAAACCGATGCGGACGCGGTGCGGGCGGACATAATCGGCCGCGAT
CTGCGGGGGCTGCTTACCCGCCTGCCGGGGCTGGAGTCGCTGGCGTTTAATGACGGCACCCCCTTTGCCG
ATGAAGTGACGCTGGGGTGGATTGGCCAACAGGTGCTGGACGATCCCGCCGCCTGGCGTGAGGAGCCGCT
CAGCGTCGCGGTGGCGGATGATGACCTGCTGACGCTGGAGCCGGAAGTGCTGGCCAGAGCCGACAGCGAC
GGCATTGAAGCCGCGCTGGGCTGGCTGCAGACGCGGCCGGGCGTCACTTCGCCGCGCGATCGTTGGCTGC
AGCGCCTGCTGATGGCCAGAGTCACGGAGCAGTACGGCAAAAACGAGATGGCGCTGCATCTGCTGGGGGA
GCTGGACAACAGCGCTCAGGCGCTGACGCTGAGCCAGTGGTCGCCGGAAATGGCCTTTGAGGTAAAAGCC
CGGCGTCTGAAGCTGCTGCGCCAGAAGGCCGCGCGTAGCGAGGCGGATAAAGTCCGTCAGCAGCCGGAGA
TGGACGCGCTGCTGGCCGGCCTGATCGCCATCGACCCGGCGCGCGCCGCGGTACTGTGCGGCTGA